Dataset for protein adenoviridae of organism Human adenovirus 53

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  :* :: .::**     :* :  : *** .                                 *: . .:*    .  :
lnq sslypel  vltsma gvkrer   gntgmmteltaslmnrkrperitwhelqmecrdel lmqdky leqikthw

       170       180       190       200       210       220       230       240
 . .:*::* :::     * .**. :: .::*: * . :.    * *: :** ::      *       :  ::*:  *:
lnpde we aikkyakia rp  kyivtktv ir acyisgnga v idt  kaafrccmm mragvmnmnsmi mnm f

       250       260       270       280       290       300       310       320
            ..:  *    ::.*  *   :* *  . ** .: . *:   . *                        
ngekfngvlfmanshmt hgcsffg nn caev g -ski  ckfygc mgvvgr ksemsvkqcvfekcylgvstegna

       330       340       350       360       370       380       390       400
          * : * . *: *: :* :.  ::                                               
rvrhcssldt cfc vkg as khn vkgctdermynmltcdsgvchilknihvtshprkkwpvfennllikchmhlgar

       410       420       430       440       450       460       470       480
*. ::*                                                                          
 gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteelrpdhlv

         .* *: *
mactgtefss g dt 
© 1998-2022Legal notice