Dataset for protein adenoviridae of organism Human adenovirus 53

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q9FFS0_E1B19K-      MEPEHPTEQGLHSGLCSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQ
E5RWD9_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
                                                                          

A0A3Q9FFS0_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
E5RWD9_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
A0A3Q9FFS0_E1B19K-      -------------------------------MDVWSILADFSK-----TR
E5RWL1_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
                                                        :* :: .::**     :*

A0A3Q9FFS0_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
E5RWD9_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A3Q9FFS0_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
E5RWL1_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
                         :  : *** .                                 *: . .

A0A3Q9FFS0_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
E5RWD9_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCSGLL-DSLNLGHQSLFQ
A0A3Q9FFS0_E1B19K-      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCSGLL-DSLNLGHQSLFQ
E5RWL1_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCSGLL-DSLNLGHQSLFQ
                        :*    .  : . .:*::* :::     * .**. :: .::*: * . :.

A0A3Q9FFS0_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
E5RWD9_E1B19K-01        ----ERVLHSLDFSSPGRTTAG-------VACVVFLVDKW----------
A0A3Q9FFS0_E1B19K-      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKW----------
E5RWL1_E1B19K-01        ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKW----------
                            * *: :** ::      *       :  ::*:  *:          

A0A3Q9FFS0_E1B19K-      MANSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
E5RWD9_E1B19K-01        --SQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPAAP----
A0A3Q9FFS0_E1B19K-      --SQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPAAP----
E5RWL1_E1B19K-01        --SQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPAAP----
                          ..:  *    ::.*  *   :* *  . ** .: . *:   . *    

A0A3Q9FFS0_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
E5RWD9_E1B19K-01        ------------------------------GLLRLHRQTSMLEEEMRQAM
A0A3Q9FFS0_E1B19K-      ------------------------------GLLRLHRQTSMLEEEMRQAM
E5RWL1_E1B19K-01        ------------------------------GLLRLHRQTSMLEEEMRQAM
                                                      * : * . *: *: :* :. 

A0A3Q9FFS0_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
E5RWD9_E1B19K-01        DEN----------------------------------------------P
A0A3Q9FFS0_E1B19K-      DEN----------------------------------------------P
E5RWL1_E1B19K-01        DEN----------------------------------------------P
                         ::                                               

A0A3Q9FFS0_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
E5RWD9_E1B19K-01        RSGLDP--------------------------------------------
A0A3Q9FFS0_E1B19K-      RSGLDP--------------------------------------------
E5RWL1_E1B19K-01        RSGLDP--------------------------------------------
                        *. ::*                                            

A0A3Q9FFS0_E1B19K-      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
E5RWD9_E1B19K-01        ---------------------------------------PSEEELD
A0A3Q9FFS0_E1B19K-      ---------------------------------------PSEEELD
E5RWL1_E1B19K-01        ---------------------------------------PSEEELD
                                                               .* *: *

© 1998-2021Legal notice