Dataset for protein adenoviridae of organism Human adenovirus 4a

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************************..    .                   
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIsgylrysr------------------
                                                      patcpvqpldtlrilslqqisqerqr

       170       180   
....:....|....:....|...
                       
-----------------------
rqqqqedqeenpragldppaeee
© 1998-2020Legal notice