Dataset for protein adenoviridae of organism Human adenovirus 4a

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3G9JTX5_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
A0A3G9K5X3_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
                        **************************************************

A0A3G9JTX5_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
A0A3G9K5X3_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
                        **************************************************

A0A3G9JTX5_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR--------
A0A3G9K5X3_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILS
                        **********************************..    .         

A0A3G9JTX5_E1B19K-      ---------------------------------
A0A3G9K5X3_E1B19K-      LQQISQERQRRQQQQEDQEENPRAGLDPPAEEE
                                                         

© 1998-2020Legal notice