Dataset for protein adenoviridae of organism Human adenovirus 34

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
              :  .:*:*::  :.     .** .*: * **                                   
mdpadsfqqgirfgfesha l dlegsqdednlq  ad ad c  npeastghasgsgggtargqpesrpgpssggggva

        90       100       110       120       130       140       150       160
                                                  :*.                         *:
dlspelqrvltgststgrdrgvkrerassgtdarselalslmsrrrpetif hevqkegrdevsvlqekysleqvktc f

       170       180       190       200       210       220       230       240
 .*          *.:.:* .::**                      :  :* :: *      **:.    : . :*:*.
ap ddwevaiknl kiaf idkd  itrrinirnacyisgngaevvidefd alid cmmdmw  lfeaealgfvn h k

       250       260       270       280       290       300       310       320
 .  . : * :  .     .: ..* .  :* *   :  . .:   ::*** . . ::   . *:               
edglngid mangklilhgaaafa lnfcl a gpqshfgcgfvacfi   grrksklrkkkc fgrcnlgilnegearv

       330       340       350       360       370       380       390       400
rhcastdtgcfilikgnasvkhnmicgasderpyqmltcagghcnmlatvhivshqrkk   fdhnvltkctmhaggrrg

       410       420       430       440       450       460       470       480
                     . :.::**:                             *. **   * *: . :     
mfmpyqcnmnhvkvllepdafqplgla  fdmnmqiwkilryddtrsrvracecggkha fp  cpa l deqpddlvia

.. * :... **::
npg efdppg  ad
© 1998-2023Legal notice