Dataset for protein adenoviridae of organism Human adenovirus 34

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q3ZL02_E1B19K-01      --------------MEVWAILEDLRKTR-----QLLEDASDGVSG-----
Q3ZL02_E1B19K-02      MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
                                    :  .:*:*::  :.     .** .*: * **     

Q3ZL02_E1B19K-01      --------------------------------------------------
Q3ZL02_E1B19K-02      TGHASGSGGGTARGQPESRPGPSSGGGGVADLSPELQRVLTGSTSTGRDR
                                                                        

Q3ZL02_E1B19K-01      ------------------------------FWR-----------------
Q3ZL02_E1B19K-02      GVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
                                                    :*.                 

Q3ZL02_E1B19K-01      -------FWFASE---------LARVVFRIKQDYK---------------
Q3ZL02_E1B19K-02      SLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISG
                              *: .*          *.:.:* .::**               

Q3ZL02_E1B19K-01      -------EEFEKLLVDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
Q3ZL02_E1B19K-02      NGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFM
                             :  :* :: *      **:.    : . :*:*. .  . : * 

Q3ZL02_E1B19K-01      TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRK
Q3ZL02_E1B19K-02      ANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSL
                      :  .     .: ..* .  :* *   :  . .:   ::*** . . ::  

Q3ZL02_E1B19K-01      MRTILGY-------------------------------------------
Q3ZL02_E1B19K-02      KKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD
                       . *:                                             

Q3ZL02_E1B19K-01      -----------------------------WPV------------------
Q3ZL02_E1B19K-02      ERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
                                                   ***                  

Q3ZL02_E1B19K-01      ---------------------QPLGVAGIL--------------------
Q3ZL02_E1B19K-02      MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVR
                                           . :.::**:                    

Q3ZL02_E1B19K-01      ---------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE
Q3ZL02_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD
                               *. **   * *: . :     .. * :... **::

© 1998-2020Legal notice