Dataset for protein adenoviridae of organism Human adenovirus 22

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------t----l--y-----g----t-------------------------------
mepehpteqglhsglrshapvegmgqaam-hnrg-vl-twsss-twss-qtnihvggrneaghgrepeerpgpsvgrgag
                            g egle la kaqhl ssaq fref                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* :: .::**     :* :  : *** .                                 *: . .:*    .  :
lmdVwtiladfSK-----tRrlvedsSDGcs---------------------------------GfwrhwfGtplsrlvy
-nq sslypel  vltsma gvkrer   gntgmmteltaslmnrkrperitwhelqmecrdel lmqdky leqikthw
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*::* :::     * .**. :: .::*: * . :.    * *: :**                         :. 
-tvkkDynEefen-----LfaDCsgll-dslNlgHqslfq----ErVlhsLD-------------------------fss
lnpde we aikkyakia rp  kymvtktv ir acyisgnga v idt  kaafrccmmgmragvmnmnsmifmnmkf
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .  ** *:.      ..:  *    ::.*  *   :* *  . ** .: . *:   . *                  
pGrttaGVaFvvflvdkwsqntqLsrgyildFaaM--hlWrAwvrqRGqrilnyWliqpavP------------------
n ekfn  l ma------nshmt hgcsffg nn caev g -skv  ckfygc mgvvgr ksemsvkqcvfekcylgv
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                * : * . *: :: :: :.  ::                                         
----------------GllrLhrqTsmleeemrqamden-----------------------------------------
stegnarvrhcssldt cfc vkg asikhnvvkgctdermynmltcdsgvchilknihvtshprkkwpvfennllikch
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *. ::*                                                                    
-----pRsgldP--------------------------------------------------------------------
mhlgar gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteel
                                                                                

       490       500  
....:....|....:....|..
               .* *: *
---------------pSeEelD
rpdhlvmactgtefss g dt 
                      
© 1998-2022Legal notice