Dataset for protein adenoviridae of organism Human adenovirus 22

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C5HDR2_E1B19K-02      MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQ
C5HDR2_E1B19K-01      ----------------------------MTHGRGLVLYKWQHLGTWAQTF
D3GBW3_E1B19K-01      --------------------------------------------------
                                                                        

C5HDR2_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
C5HDR2_E1B19K-01      REF---------------------------LMDVWTILADFSK-----TR
D3GBW3_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
                                                      :* :: .::**     :*

C5HDR2_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
C5HDR2_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
D3GBW3_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
                       :  : *** .                                 *: . .

C5HDR2_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYIS
C5HDR2_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCSGLL-DSLNLGHQSLFQ
D3GBW3_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCSGLL-DSLNLGHQSLFQ
                      :*    .  : . .:*::* :::     * .**. :: .::*: * . :.

C5HDR2_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
C5HDR2_E1B19K-01      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
D3GBW3_E1B19K-01      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
                          * *: :**                         :.  * .  ** *

C5HDR2_E1B19K-02      MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKVRGCKFYGCWMGVVG
C5HDR2_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
D3GBW3_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
                      :.      ..:  *    ::.*  *   :* *  . ** .: . *:   .

C5HDR2_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKH
C5HDR2_E1B19K-01      VP----------------------------------GLLRLHRQTSMLEE
D3GBW3_E1B19K-01      VP----------------------------------GLLRLHRQTSMLEE
                       *                                  * : * . *: :: 

C5HDR2_E1B19K-02      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
C5HDR2_E1B19K-01      EMRQAMDEN-----------------------------------------
D3GBW3_E1B19K-01      EMRQAMDEN-----------------------------------------
                      :: :.  ::                                         

C5HDR2_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
C5HDR2_E1B19K-01      -----PRSGLDP--------------------------------------
D3GBW3_E1B19K-01      -----PRSGLDP--------------------------------------
                            *. ::*                                      

C5HDR2_E1B19K-02      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
C5HDR2_E1B19K-01      ---------------------------------------------PSEEE
D3GBW3_E1B19K-01      ---------------------------------------------PSEEE
                                                                   .* *:

C5HDR2_E1B19K-02      TD
C5HDR2_E1B19K-01      LD
D3GBW3_E1B19K-01      LD
                       *

© 1998-2022Legal notice