Dataset for protein adenoviridae of organism Human adenovirus 21

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            *  :
--------------------------------------------------------------------------mgVwdl
mdppnplqqgirfgfhsssfvenmegsqdednlrllasaasgssrdtetptghasgsgggaaggqsesrpgpsgge aai
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :*.  *:*  .:*.* .                               :*.                         *:
lpeLr--RvLtrstSsGvsr------------------------------wWr------------------------fWl
fed kqt l lena d qdggikrernpsgnnsrtelalslmsrrrpetvf hevqsegrdevsilqekysleqlktc f
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :          *.: :* .::**               :  * ::* .             **:.       :*: .:
gpe---------yArlvlRpkqqYR---------------ngfEvllDts-------------PGvvgm-----mNlrhq
egdddwevairnl kisf idkd  itkkinirnacyisgeea kii dqdktafrccmmgmw  lfeaeavtfl igfk
                                                    a                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   : :: : : .   . .: ..* .  :: *    :*   *   ::                                
ghgynkvvsvlntstplrtcsavgFnttivekW----vRqtsFykgyvlt------------------------------
adfkegilfmadfklighgaalfa lnfclda gqvsi gch sacwiadsgrvksqlsvkkcmfercnlgilnegearv
                     f              g                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .*.:  ...*                    
--------------------------------------------------hIvshlwrtW--------------------
rhcaatetgcfilikgnasvkhnmicghsnerpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrg
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       : ..:..:*:  ... :.::**:     :  :*  :: : . **                             
-------nmrrvrvmLeywpvsrvsvtGIlrmppqmwkvLryeqtkprvRA-----------------------------
mfmpyqckanhmkti dpdafqplgla  fdhnialpai eeddqednp  cecggkharfqpvcvdvtedlrpdhlvla
                                                                                

       490    
....:....|....
      * .    :
------Gssppvte
ctgaef ldgeeed
              
© 1998-2022Legal notice