Dataset for protein adenoviridae of organism Human adenovirus 21

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0B4SJH1_E1B19K-      MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
Q2KS85_E1B19K-02        MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
A0A0B4SJH1_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
                                                                          

A0A0B4SJH1_E1B19K-      TGHASGSGGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTSSGQDR
Q2KS85_E1B19K-02        TGHASGSGGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTSSGQDR
A0A0B4SJH1_E1B19K-      ------------------------MEVWAILEDLKQTRLLLENASDGVSG
Q2KS85_E1B19K-01        ------------------------MEVWAILEDLRQTRLLLENASDGVSG
                                                  *  :: :*.  *:*  .:*.* . 

A0A0B4SJH1_E1B19K-      GIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q2KS85_E1B19K-02        GIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
A0A0B4SJH1_E1B19K-      ------------------------------FWR-----------------
Q2KS85_E1B19K-01        ------------------------------FWR-----------------
                                                      :*.                 

A0A0B4SJH1_E1B19K-      SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISG
Q2KS85_E1B19K-02        SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISG
A0A0B4SJH1_E1B19K-      -------FWFGGD---------LARLVFRIKQDYR---------------
Q2KS85_E1B19K-01        -------FWFGGD---------LARLVFRIKQDYR---------------
                                *:  :          *.: :* .::**               

A0A0B4SJH1_E1B19K-      NGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFM
Q2KS85_E1B19K-02        NGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFM
A0A0B4SJH1_E1B19K-      EEFEKLLDDS-------------PGLFEA-----LNLGHQAHFKEKVLSV
Q2KS85_E1B19K-01        EEFEKLLDDS-------------PGLFEA-----LNLGHQAHFKEKVLSV
                        :  * ::* .             **:.       :*: .:.   : :: :

A0A0B4SJH1_E1B19K-      ANTKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSV
Q2KS85_E1B19K-02        ANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSV
A0A0B4SJH1_E1B19K-      LDFSTPGRTAAAVAFLTFILDKW----IRQTHFSKGYVLD----------
Q2KS85_E1B19K-01        LDFSTPGRTAAAVAFLTFILDKW----IRQTHFSKGYVLD----------
                         : .   . .: ..* .  :: *    :*   *   ::            

A0A0B4SJH1_E1B19K-      KKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN
Q2KS85_E1B19K-02        KKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN
A0A0B4SJH1_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
                                                                          

A0A0B4SJH1_E1B19K-      ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
Q2KS85_E1B19K-02        ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
A0A0B4SJH1_E1B19K-      --------------------FIAAALWRTW--------------------
Q2KS85_E1B19K-01        --------------------FIAAALWRTW--------------------
                                            .*.:  ...*                    

A0A0B4SJH1_E1B19K-      MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
Q2KS85_E1B19K-02        MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
A0A0B4SJH1_E1B19K-      -------KARRMRTILDYWPVQPLGVAGILRHPPAMPAVLEEEQQEDNPR
Q2KS85_E1B19K-01        -------KARRMRTILDYWPVQPLGVAGILRHPPAMPAVLEEEQQEDNPR
                               : ..:..:*:  ... :.::**:     :  :*  :: : . *

A0A0B4SJH1_E1B19K-      ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
Q2KS85_E1B19K-02        ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
A0A0B4SJH1_E1B19K-      A-----------------------------------GLDPPVEE
Q2KS85_E1B19K-01        A-----------------------------------GLDPPVEE
                        *                                   * .    :

© 1998-2022Legal notice