Dataset for protein Mcl-1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----mf--lkrna--viglnlyc---------ggaglg---------agsggatp-pggrll-----------------
mmnym--gk-----  --------lilpqngvv----hyg plcyfsp----sp--a--s--datnkeasarreigggea
 amiinmiprqmkt  tattamnyylfsncagleppm--d        ssds--qipma-si-ssegnvtpqstvsndtp
 tsmlslsnfnacr  lskgqvmsffitsqtfgdhqtgsr        qenlvsavespatkaghgaipgseqvapseak
   fppsastrqtp  ntfrmtsnmmtlpgsptnrtldas        ppgvatssslsppvetavssmdvat gedpql
   l kqkrqstll  fqlkgfitcvvfcaccqtlgsrtc        tklmtgentvtevsvvrheplat   pvqass
     tntqmakfn  plmqvpgesywrad  aatlvklq        lapplrraltktkmgrlldlkvl    ltnrm
      inlktlam  svsvtnvdisnvk   rssiisfa        evetcnpediedgpcpeawggyg    tvrnq
      gmtvmpys  idrnsidmgpcch   fi sypcp        rrkriigtrknretsddrrack      e fg
      a  spssk  gppfpaawnnsa    e  fpmql        g anhvxf g la m ykpd        c df
         p nmf    qpr tqa          whadh          va  nd r  q   vi          a y 
           evy     hk cl           nav             q  cr q      qf            v 
            rg     e   i           h               i   l        c               
            d      c                                   g        p               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gaviggsagagligggprasppaaltpdarrvarpppigaevpdvtatparllffaptrrasppeemeapaadaimspee
ltgetetwa agraeai pkasstvaegssgavphs vagagsrrsgswpkrflleiglcsaalakvagsrpavlwc gd
 e sa lp             qtprs rp vligga r tparnlatpdspsqrasapclvggrg qssgisvspll dg
 m                    nvpv ig p    g   s laa vpdatgp  kl  yncvced  pdav ggap    
 i                    gsfl               d   i a e        hd e      tws         
                       l                         m                  klg         
                                                 g                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------krpavlp----vg----k------------------dgslpstpppa
eldgyepeplg                      -------llel--eysn-spred   sdd   sgst-----c--e--
r grc edspa                      rnsknpgvtstnspaaagnsqqs   rss     geedtvg-st-lq
d  av  aaes                      pkrtdremngskrksgtsaipdn   hvr     ddg kelngsafh
        lsr                      gqqsrsatsarae pvsngllvv   tee     man ds tpldme
        e e                      lpaqa dsvpmsp lqlrrffkl   vav     vsq aq pl lqd
                                 hgeds q ptard rkgdetva    dcg     eph  p l  sss
                                 ea nk v mlkp  ntvttrhs    gyt     nlt  g a  fyp
                                 v  lt s imi   hlpephgt    ath     imk        tv
                                 t  fg r adn   fprckd      qg      cg         vm
                                 q  ee    vf   emk  g      l       a          i 
                                          q    ged  e              t            
                                                                   r            
                                                                   p            
                                                                   l            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e----e-----------------------------------elyrdtlelisrflr---eqatgakdt------------
-dset-eed                         cpagde --e-qsr-i---y-- y dftglsqprgtkpkfsfq   
seegadvss                         ssesnq vi-n---q-lts-fk   -------savkg         
lpddvsdpg                         vnseid a dse klfvhqlyg   nyvvitr-q            
plcyslada                         dgkaqt q net trv rnsmq   tasarppck            
ctgvdyllv                         prt hg l rq  ss  gd  l   gvidhcty-            
dnvskvptf                         yqr yv t fg  mk  lt  a   shr e ers            
t thepgch                         qhd sp r  t   h  cg      iee m hag            
g p pgi                            f  g  p  m      fw      l   a gqp            
a   nat                            c  e  g  k      ei            ied            
h   mm                                a     a      da            avc            
    l                                       w      i              h             
    f                                       h                     t             
                                            d                     k             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------atsr-----kale-TlrRVgd--gvqrkHetafqGMlrkLdikne
              lfpgllggpgkpmgrsg    waeseaevar--sv-mk--ve  dllen-rytyn-winrvslddr
                        rtlrgar    rkqn     -yvk  --g -a  ---d-ykiv-k -vqg---eeq
                        sqgfefs    -r-t     pvm-  as  a-  nivv  -l-s- i-c- em--k
                        qla av     ssr-     eeiq  ip   n  smis  q-sls  qvn nfhq-
                        g    p     hndh     qsht   n   g  k m-  lf  t  mae a qkt
                        e          g-hg     hp p          t ra  sm  p  f-  c  sn
                                   lgpk     gt d          r aq  tr  l   s  q  gi
                                    vle     d  v          e  t  g       k  g    
                                    hgq        r             l          t       
                                    dt         a             h                  
                                    ym                                          
                                    c                                           
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .                                                           
d-dvkslsrvavhvFsDgvTNWGRivtlisFGAfvakhlkeinqescieplaesitdyLvrtkRdWlvknrgW---dGFV
gd-msfvta-mkslparrtrr ---as-va---v-cqy--skgrgnyvdlvsqecstv-lseqks ilnqns-   e---
eenlg-igsi-i-i g hii    v--fl- cvals--qntr-hdhsaagfgrcvws- -td-qe f---ka    - le
-gs--a--etitem c sp      t v-t ag- -srme--qkqkatss cgifcaa t--egn  irh--    h c 
pa itifr-av-t  k kn      s  mg   m  vsf dmhlsdr rr ikq akf sks  q  aseg     s   
s  aqv kt tan  r  a                 lq  kts  q  tq  vh     mqn  a  mq q     k   
n   rk cq per  n                    ek  avk  g  nt  sk      eh              n   
v   h  pk grq  e                        ql   e  gn  d       ay              g   
q   e  ac  ql                            s       a          la                  
h   d   g  s                             n                   k                  
r   a      n                             c                                      
l                                        h                                      
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
eFFhveDlEgg------------irnv------llafagvaGvgaglA----------yl-----------------ir-
---r-a-p-st            v--t      -m--v-f--isnti-qlsrmaifkgl-                 --c
d v-es - --            -kh-       -tv-s- tl--s-v vnm      fm                 mst
a dqi- t ts            m ta       vglltl s-  k t          -w                 s a
q  kqp v aa            l kg       f igci  s  l p          mf                 a s
   y q s li            c es       i  f c     -            qp                   k
     d y  k                            a     a            dk                   g
     t a  v                                                                    y
          r                                                                    r
                                                                               n
                                                                               f
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
wlallrtqstrssafgvrsstsg rllr  s r   a                          cwr           r  
lskfslqkrlin ss s pqqgr    l                                                    
rdvmgghlqag  r  a  p                                                            
nthvfe  k e  l     c                                                            
crts                                                                            
vnsn                                                                            
smek                                                                            
m                                                                               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660   
....:....|....:....|...
                       
-----------------------
                       
                       
                       
                       
                       
                       
                       
                       
                       
                       
                       
                       
                       
                       
© 1998-2020Legal notice