Dataset for protein Mcl-1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----mfg-l-rna--viglnlyc---------------------------glgag-sggatppg---------------
mnimn---p-k---ts--------apntpaspggga               -pqn-v-----h--grllatekeasarre
 mmislinkfqmkplattavmyli         a g               f---sggespm-ydappvyagpsgtsspq
 slppssp trtlkntkcmmsscl           p               lsncvsvdpqsssspvgahsaeapdvvar
 dflknak ymatlrqfgttgcfm                           tfaqpflshtlrgastss vsttsnmast
    tvta sakfrvnlvvfiemv                           ivme ttntlpgqres c ftrqratqta
     qls rtprspvqqrqamif                           srst paanggdttce      pelllqv
     ikr qssanfisaqpvdns                           vmpp cetliaarc        g eftlm
     g q klnytgpprs qwsp                           ng l  qqrsykfh        v pppgk
       t vp vmalmpp dthn                           c  d   kmnvldf          vnek 
       l mn sg d nn cn                             m      iawnec           mic  
            d    kl  i                                      vica           krn  
                 hk  f                                      mh              qd  
                                                            ff              g   
                                                            d                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---g-------g--------------rp--l-------------------------------------------------
igg-sagdvig-sagsgligsndtak--an-apdarrvarpppigaevpdvtatparllffaptrrasppeemeapaada
vampeslaslnanvspagraeseqpspskaptvtstngvphs vagagsrrsgswpkrflleiglcsaalakvagsrpav
aplaatitehvsppda    tggaspkrttvemspskasgga r tparnlatpdspsqrasapclvggrg qssgisvs
nsvkgpvearhdtlag    gdprlrslsdaglnglgsp  g   s laggvpdatgp  kl  yncvced  pdas gg
tetsdvkptslrimvi    vtaskllqqstvtgtgpli        d a i a e        hd e      twg   
gtsntkwcredeyge     pennmva nksqyrmkep                 m                  kl    
pnirrlmscdtwlkr     lalfqq  drrdrvnavf                 g                        
l qe gempqr dw       ciyf   lpfsikkple                                          
f ft fsggpa  c         vr   vl reldn                                            
  d  rtidck  t         p    ri pai                                              
  p  qp kt   i         g    iv l p                                              
     i                      ge   m                                              
                                 a                                              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------krpavl-------e--------dgslpstpppaee------
imspeeeldgyepeplg                      ------pllelvg-agngspst--------e---dsetde 
lwc gdr gacpsdspr                      yatksiredgmasdssssgsgdeddvgcss-lqs-egaev 
pll dgd  rv eaaea                      lvarnfqvspiprsdagnetdegstslngtafhlpddvsd 
ap            lss                      hqvnrrgqnls hvreakteman ke tpldmedlcysya 
              e e                      rlsdasaspsr tapmkdndvsq aq pl lqdcggvdpl 
                                       gklsghsavqf vte  e gepv  g a  ssstnvspap 
                                       esrtqglkt   qcg     nlt    l  fvpp tllvg 
                                       nghettfda   dyv     imr        tvg pckni 
                                       fdg ppvt    ekt     cgk        ith n ems 
                                       ctf k  n    ag      a h        ama f nlf 
                                         d e       l       t                mg  
                                                           r                    
                                                           p                    
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------e-elyrdtlelisrfl-----------------------------------
                      sscpagd-d--e-qsr-i---y-                    reqatgakdtgtkpk
                      pgssssndavf-n---q-lts-f                    lvavvetesavkg  
                      tavneeiq aidse klfvrqsy                     cfrg sgps     
                      dvdrkaqp q net trv gnlm                      e a p ek     
                      chpqt ht l rq  ss  hd                          d c qg     
                      lfygr yg t fg  mk  lt                                     
                       drhd sv r  t   h  cg                                     
                        qf  gm p  k   a  fw                                     
                         c  e  m  m      ei                                     
                                  a      da                                     
                                  w      i                                      
                                  h                                             
                                  d                                             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------kpfggsgaa-r-----kaleTlrRVgd--gvqrkHet---afqGMlrkL
fsfq                 lfpgllggpgrdmtrlsqtsqwkesarv-s-mk--ve  dllen-ry   tyn-winrv
                               -nl----kpq-rrqn --mk --g -a  -ivd-yki   v-k -vqg-
                               g-yvtip-spkhgdt pyi- as  an  n-iv  -l   -l- i-c- 
                               qt-seacs-ngsnrh eevt in   -  sm-s  q-   sss  tvn 
                               aehrartprmsgstr gsqq      g  k m-  lf     t  qae 
                               tlgi mrgckpttlk qphp         t aa  gm     p  mk  
                               egvf hqrygneyhg ht v         r rq  tr     l  f-  
                                sal fatv d hgv    d         e  l  s          s  
                                i c v hh c e e    a            w             t  
                                  a t iq w c d                 t                
                                    p ld e a                   h                
                                       l                                        
                                       k                                        
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .                                                      
dikne-ddvkslsrvavhvFsDgvTNWGRivtlisFGAfvakhlkeinqescieplaesItdyLvrtkRdWlvknrgW--
slddrge-msfvta-mkslparrtrr ---as-va---v-cqy--skgrgnyvdlvsqecstv-lseqks ilnqns-  
--e-qp-nlg-igsi-i-i g hii    v--fl- cvals--qntr-hdhsaagfgrcvws- -td-qe fi--ka   
em-ekdgs--a--etitem c sp      t v-t ag- -srme--qkqkrtss cgifcaa t-segn  -rh--   
n hq-sn itifr- v-t  k kn      s  mg   m  vs  dmhlsda rr ikq akf sk-  q  aseg    
a qktva aqv kt tan  r  a                 lq  kts rq  tq  vh     mqn  a  mq q    
c  snq   rk cq per  n                    ek  avk  g  nt  sk      eh             
q  gil   h  pk grq  e                        qn   e  gn  d       ay             
g        e  ac  ql                            l       a          la             
         d      s                             s                   k             
         a      n                             c                                 
                                              h                                 
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-dGFVeFFhveDlEgg------------irnvLlafagvaGvgaglAyl-----------------ir------------
 e------r-a-p-st            v--t-m--v-f--isnti-l-                 --cwsalllpqstr
 - ced d-es - --            -kh- -tv-s- tl--s-vfm                 msslrkkgrtlrai
 h   a  qi- t ts            m ta vglltl s-  k tqw                 smkcdvmsgqkqlg
 s   q  kqp v aa            l kg i igci  s  l p-v                 n gvitfqeha ce
 k      y q s li               s f  f c     -  mk                   asnsv       
 n        d y  k                      a     a   f                   ynmi        
 g        t a  v                                                    tmlf        
               r                                                    ra e        
                                                                    n           
                                                                    m           
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ssasrsrsstsgsr  r  s r   a                          cwr           r             
lhlf nk crgr                                                                    
t n  a                                                                          
n                                                                               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650  
....:....|..
            
------------
            
            
            
            
            
            
            
            
            
            
            
            
            
            
© 1998-2020Legal notice