Dataset for protein Mcl-1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

180 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----MFG-FQV----VIRLNLYC--------------------------
A0A3P8V8T6_MCL1-01      ---------LDMVLISSVCLTLCT--------------------------
U3KKY6_MCL1-01          ---------KKNKK------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          -----MFG-LRRNA--VIGLNLYC---------GGA--------------
A5PJR2_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A452GA25_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
G1L3L7_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
G1T2Q0_MCL1-01          ---MAMFS-LRRNA--VIGLNLYL---------GGP--------------
F7AVA6_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A337S3J9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A337S3J9_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
Q7YRZ9_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
F1PAP1_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
Q8HYS5_MCL1-01          -----MFG-LKRNA--VIRTQLYC---------GGA--------------
M3XZZ5_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A452RHX5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
H0XFB7_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
F7GTF7_MCL1-01          -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K5CFH3_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K6V5Y3_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K6KRW9_MCL1-01      -----MFG-FKRNA--VIGLNLYC---------GGA--------------
A0A2K5XSB2_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A0D9RZP5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
I7G687_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K5LXU8_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3GJZ3_MCL1-02      -----MFG-LRRNA--VIGLNLYC---------GGA--------------
H2N5Y9_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2R9BPJ5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3RTV4_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I2YQH7_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K5C7L5_MCL1-01      -----MFG-LQRNA--LIGLNLYC---------EWA--------------
A0A2K5I9I0_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6GI15_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3GJZ3_MCL1-01      -----MFG-LRRNA--VIGLNLYC---------GGA--------------
A0A2K5CFH3_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K5R5E2_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K5W0W9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6ECR0_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3LFM0_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6KRW9_MCL1-02      -----MFG-FKRNA--VIGLNLYC---------GGA--------------
A0A2K6PPI3_MCL1-02      -----MFG-FKRNA--VIGLNLYC---------GGA--------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B6V6J0_MCL1-01          MMHQSVIAKQRPSTSFLIPCQFYC--------------------------
G3PJT0_MCL1-01          ------MNIIQRPK--LAALNMTGVMSCIILPQNGVAPMRQLAMGSAKDS
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      ------------DL--WINLGISC---------GRA--------------
G1QAV8_MCL1-01          -----MFG-PKRNA--FIGLNLHC---------GGAVGGLWRQRSLHLLQ
H9GEA6_MCL1-02          -----------------------MAPNTPASPGAGG--------------
H9GEA6_MCL1-01          -----MFNKKSMVL--VCGGAPSMAPNTPASPGAGG--------------
A0A493U0E8_MCL1-01      -----------------------------------G--------------
A0A1L1RNM6_MCL1-01      -----MFA-VKRNA--VIGFNLYC---------GGG--------------
A0A1L1RNM6_MCL1-02      -----MFA-VKRNA--VIGFNLYC---------GGG--------------
G2HFR3_MCL1-01          MDICRLSAAMREFY--IVHLDIY---------------------------
F6ZMX1_MCL1-01          -----MLGPFKKNA--VIGLNLYC---------GGA--------------
F6ZMX1_MCL1-03          -----MLGPFKKNA--VIGLNLYC---------GGA--------------
F6ZMX1_MCL1-02          -----MLGPFKKNA--VIGLNLYC---------GGA--------------
G1T2Q0_MCL1-02          -----MFS-LRRNA--VIGLNLYL---------GGP--------------
F1PAP1_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A337S3J9_MCL1-04      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
F7AVA6_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6GI15_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
C8YZ26_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
F7GTF7_MCL1-02          -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K5R5E2_MCL1-04      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K6V5Y3_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A2K5LXU8_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K5I9I0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I2YQH7_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
Q07820_MCL1-04          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K5W0W9_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6ECR0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K5XSB2_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2R9BPJ5_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3RTV4_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2I3LFM0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A2K6PPI3_MCL1-03      -----MFG-FKRNA--VIGLNLYC---------GGA--------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A287DCH9_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
P97287_MCL1-01          -----MFG-LRRNA--VIGLNLYC---------GGA--------------
A0A452GA25_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A287DCH9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGA--------------
G3T756_MCL1-01          -----MFG-FKRNA--VIGLNLYC---------GGA--------------
A0A1S3F3I1_MCL1-01      -----MFG-LRRNA--VIGLNFYC---------GGA--------------
G1L3L7_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGA--------------
A0A287BK44_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A287BK44_MCL1-02      -----MFG-LQRNA--VIGLNLYC---------GGA--------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      ---------------------MNV--------------------------
A0A3B5K5B3_MCL1-01      ---------MNIIANHTALRIMNV--------------------------
A0A3B3IJ04_MCL1-01      -----------MFPLQKQMVNSYI--------------------------
A0A3P9L1F3_MCL1-01      -----------MFPLQKQMVNSYI--------------------------
A0A3B3IJ04_MCL1-02      -----------MFPLQKQMVNSYI--------------------------
A0A3P9L1F3_MCL1-02      -----------MFPLQKQMVNSYI--------------------------
A0A3B3CEX1_MCL1-02      -----------MLPLQKHMVNSYI--------------------------
A0A3B3CEX1_MCL1-01      -----------MLPLQKHMVNSYI--------------------------
A0A3Q3B4P5_MCL1-01      -------------MFPKPKPSYIF--------------------------
A0A3Q3B4P5_MCL1-02      -------------MFPKPKPSYIF--------------------------
A0A3Q2EDX8_MCL1-01      -------------------MSYLI--------------------------
A0A3Q2P7X9_MCL1-01      ----------MSKAPTSTQLVNCL--------------------------
A0A3Q2P7X9_MCL1-02      ----------MSKAPTSTQLVNCL--------------------------
A0A3B5PQ55_MCL1-02      -----------MTANSTNALNYLI--------------------------
A0A3B5PQ55_MCL1-01      -----------MTANSTNALNYLI--------------------------
A0A3P9Q4I8_MCL1-02      -----------MTANSTTALNYLI--------------------------
A0A3P9Q4I8_MCL1-01      -----------MTANSTTALNYLI--------------------------
A0A087X830_MCL1-01      -----------MTANSTTALNYLI--------------------------
A0A3B3YCD0_MCL1-01      -----------MTANSTTALNYLI--------------------------
I3JHR5_MCL1-01          -----MTN-FLMSKRNQCTFIDYL--------------------------
A0A3Q4HLQ8_MCL1-01      -----MTN-YMMSKRNQCTFIDYL--------------------------
A0A3P8NP63_MCL1-02      -----MAN-YMMLKRNQCTLMEYL--------------------------
A0A3Q2VNL8_MCL1-01      -----MAN-YMMLKRNQCTLMEYL--------------------------
A0A3P8NP63_MCL1-01      -----MAN-YMMLKRNQCTLMEYL--------------------------
A0A3P9BVM3_MCL1-01      -----MAN-YMMLKRNQCTLMEYL--------------------------
A0A3B4G4Z6_MCL1-01      -----MAN-YMMLKRNQCTLMEYL--------------------------
A0A2U9CJ81_MCL1-01      MNIIPSTK-RAAFNVTTGVMGCLI--------------------------
A0A3P8VKM5_MCL1-05      MNIIKN-N-QAKLNVATGVLGCFI--------------------------
A0A3P8VKM5_MCL1-04      MNIIKN-N-QAKLNVATGVLGCFI--------------------------
A0A3P8VKM5_MCL1-03      MNIIKN-N-QAKLNVATGVLGCFI--------------------------
A0A3Q3IZW0_MCL1-01      MNIITS-K-KWADVNVTTEIMSLI--------------------------
A0A3Q1GX28_MCL1-02      -MLPSG-R-TAMKL-ATGGMSCLM--------------------------
A0A3Q1GX28_MCL1-01      -MLPSG-R-TAMKL-ATGGMSCLM--------------------------
A0A3B4XKA5_MCL1-01      MNLIQA-P-KQAAL-T--AVNYCI--------------------------
A0A3Q3GP42_MCL1-01      MDIINM-K-RAAVS-VSAGVMSFM--------------------------
A0A3Q3M6G2_MCL1-01      MSFIPS-T-RRAAL-IP-GVM-IV--------------------------
A0A3Q3M6G2_MCL1-02      MSFIPS-T-RRAAL-IP-GVM-IV--------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          ----------------------MS--------------------------
Q1L8X3_MCL1-01          ----------MALSLDFRRTATMS--------------------------
Q9I9N3_MCL1-01          ----------MALSLDFRRTATMS--------------------------
W5MMB7_MCL1-01          ---MSLSS-LKRTSASAVIQLYCP--------------------------
A0A3B3R4U0_MCL1-01      ---MNLIN-RTTATGLF-----CP--------------------------
A0A3B3SG34_MCL1-01      ---MNPQS-LKSYAPIMVSMNYHR--------------------------
A0A3Q2Y539_MCL1-01      --MPESKR-FPLYNFKVGLVDALM--------------------------
Q4SW32_MCL1-01          ---MSVIA-NRTAIDTM-----NV--------------------------
D2ITA0_MCL1-03          --MLSQKL-TSNYGTSLVQTCWFN--------------------------
D2ITA0_MCL1-04          --MLSQKL-TSNYGTSLVQTCWFN--------------------------
A0A3P9ILF6_MCL1-01      -----------MFPLQKQMVNSYI--------------------------
A0A3P9ILF6_MCL1-02      -----------MFPLQKQMVNSYI--------------------------
Q0KFR9_MCL1-01          ---MSLSN-SITRATTT-----ML--------------------------
A0A3P8Y1W8_MCL1-02      ---MNLSK-SLTRATTT-----ML--------------------------
A0A3P8Y1W8_MCL1-01      ---MNLSK-SLTRATTT-----ML--------------------------
A0A3Q2XZL8_MCL1-01      ---MSMVQ---PTSQVLKPQGRPM--------------------------
A0A3B4AFB7_MCL1-02      ---MNIIN-SPKRTALKLSTMGLF--------------------------
A0A3B3VM25_MCL1-01      -----------MTANSTTALNYLI--------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --MNTCTM-RNCRMGSYKNVMDLF--------------------------
A0A3B4T8L9_MCL1-02      ---MNLIQ-S-PKPTAFTAMNYCI--------------------------
A0A3B4T8L9_MCL1-01      ---MNLIQ-S-PKPTAFTAMNYCI--------------------------
A0A3Q1EQB9_MCL1-02      ---MNMIP---TKRTTL--MNCLI--------------------------
A0A3B4ZKP6_MCL1-01      ---MNIIP-T-TKRTAL--MSCFI--------------------------
A0A3Q1BKL8_MCL1-02      ---MNMIP-TTTKRTAF--MNYLI--------------------------
A0A3Q1EQB9_MCL1-01      ---MNMIP---TKRTTL--MNCLI--------------------------
A0A3Q1BKL8_MCL1-01      ---MNMIP-TTTKRTAF--MNYLI--------------------------
A0A3P8RQX7_MCL1-01      ---MNMIP-TTTKRTAF--MNYLI--------------------------
A0A3P8RQX7_MCL1-02      ---MNMIP-TTTKRTAF--MNYLI--------------------------
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      ---------GAIPPGPRLL-------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -GYNADGSVPPSPPT-----------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -------------MGGSL--------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          -SLGAG---GGSPAGTRLAA--EEAKARRE-GGGEA--------------
A5PJR2_MCL1-01          -GLGQG-S-GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG-----
A0A452GA25_MCL1-01      -GLGQG-S-GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG-----
G1L3L7_MCL1-01          -GLGAG-SGGGXS-GGRLLASGKEATARREIGGGEAGAVIGGSAG-----
G1T2Q0_MCL1-01          -GLGAG-GGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPG-----
F7AVA6_MCL1-01          -GLGAG-GGGASSPGGRLLAAGKEATARREGGGGEAGAVIGGSAG-----
A0A337S3J9_MCL1-01      -GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-----
A0A337S3J9_MCL1-03      -GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-----
Q7YRZ9_MCL1-01          -GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-----
F1PAP1_MCL1-01          -GLGAG-SGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAG-----
Q8HYS5_MCL1-01          -GLGAG-SGGASSSGGRLLASGREATTRREGGGGEAGAVIGGSAG-----
M3XZZ5_MCL1-01          -GLGAG-TGGASSSGGRLLASGKEATARREVGGGEAGAVIGGSAG-----
A0A452RHX5_MCL1-01      -GLGAG-SGGAASSGGRLLASGKEATARREVGGGEAGAVIGGSAG-----
H0XFB7_MCL1-01          -GLGAG-SGGATPPGGRLLAAEKEAAARREAGGGEAGEVIGGSPG-----
F7GTF7_MCL1-01          -GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAG-----
A0A2K5CFH3_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG-----
A0A2K6V5Y3_MCL1-01      -GLGAG-SGGATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAG-----
A0A2K6KRW9_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-----
A0A2K5XSB2_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A0D9RZP5_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
I7G687_MCL1-01          -GLGAG-SSGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A2K5LXU8_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A2I3GJZ3_MCL1-02      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
H2N5Y9_MCL1-01          -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
A0A2R9BPJ5_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
A0A2I3RTV4_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
A0A2I2YQH7_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
A0A2K5C7L5_MCL1-01      -GLGTG-SGGTTPPGGRLLATEKEASAQREVGGGEAGVVIGGSAG-----
A0A2K5I9I0_MCL1-02      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A2K6GI15_MCL1-01      -GLGAG-SSGATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPG-----
A0A2I3GJZ3_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-----
A0A2K5CFH3_MCL1-03      -GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG-----
A0A2K5R5E2_MCL1-03      -GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSVG-----
A0A2K5W0W9_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A2K6ECR0_MCL1-02      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-----
A0A2I3LFM0_MCL1-01      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGGTAG-----
A0A2K6KRW9_MCL1-02      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-----
A0A2K6PPI3_MCL1-02      -GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-----
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B6V6J0_MCL1-01          -SGGGSSEKTLSARGASPW-------------------------------
G3PJT0_MCL1-01          HNGNAGTNDTPKRPSALGV-------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      -DL-----------------------------------------------
G1QAV8_MCL1-01          EGGPCPQESGAGRETGTVI------------------------------G
H9GEA6_MCL1-02          -GVGESSGGNNNDGGGVSV-------------------------------
H9GEA6_MCL1-01          -GVGESSGGNNNDGGGVSV-------------------------------
A0A493U0E8_MCL1-01      -GWGTESWRNTSWPSKGPARSDHLGSV---------------LWKSEASS
A0A1L1RNM6_MCL1-01      -SPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRA
A0A1L1RNM6_MCL1-02      -SPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRA
G2HFR3_MCL1-01          -----------PPPECTIH-------------------------------
F6ZMX1_MCL1-01          -GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIG
F6ZMX1_MCL1-03          -GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIG
F6ZMX1_MCL1-02          -GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIG
G1T2Q0_MCL1-02          -GLGAG-GGGVAPPAERLL-------------------------------
F1PAP1_MCL1-02          -GLGAG-SGGASSSGGRLL-------------------------------
A0A337S3J9_MCL1-04      -GLAAG-SGGASSSGGRLV-------------------------------
F7AVA6_MCL1-02          -GLGAG-GGGASSPGGRLL-------------------------------
A0A2K6GI15_MCL1-03      -GLGAG-SSGATPPGGRLL-------------------------------
C8YZ26_MCL1-01          -GLGAG-SGGATRPGGRLL-------------------------------
F7GTF7_MCL1-02          -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K5R5E2_MCL1-04      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K6V5Y3_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K5LXU8_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K5I9I0_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2I2YQH7_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
Q07820_MCL1-04          -GLGAG-SGGATRPGGRLL-------------------------------
A0A2K5W0W9_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K6ECR0_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K5XSB2_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2R9BPJ5_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2I3RTV4_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2I3LFM0_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A2K6PPI3_MCL1-03      -GLGAG-SGGATPPGGRLL-------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          -GLGA---------------------------------------------
A0A287DCH9_MCL1-02      -EV-----------------------------------------------
P97287_MCL1-01          -SLGA---GGGSPAGARLVA--EEAKARREGGGE----------------
A0A452GA25_MCL1-02      -GLGQ--GSGASSPGGRLLAAGKEATAR---------------AG-----
A0A287DCH9_MCL1-01      -GLGA--SGGATPPGAQLLAAEKEAAARREAGGGE---------------
G3T756_MCL1-01          -GLGA--GGCATPPGGRLPAPGKEATARQEVGGGD--------AG-----
A0A1S3F3I1_MCL1-01      -GLGAGSGAAAA-PGGRLL-TAEEASARREAGGGEAGAGIGGSAG-----
G1L3L7_MCL1-02          -GLGAGSGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG-----
A0A287BK44_MCL1-01      -GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG-----
A0A287BK44_MCL1-02      -GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG-----
A0A3B1IEV7_MCL1-01      ---MNPTAISLLCDG--------TSPVLYRTEKEEKLPRTERPERG----
A0A3B4CGU9_MCL1-03      ---MESAAISLFCNG--------AGRIPFNKGSESQLDRPDRPDRG----
A0A3B4CGU9_MCL1-02      ---ME-------AHG--------GVQINMAAHPGGSICAPVLHGSS----
A0A3Q3VP02_MCL1-01      -LFQNGVVSGPTR--------------SSQIGMGSCLDSHNGNVAL----
A0A3B5K5B3_MCL1-01      -VFQNGVVDGAGH--------------SSPL----IPMASRGSLSG----
A0A3B3IJ04_MCL1-01      -TSNCGFTGHILGSR--------AGEMSARVPLPSTLASHVANPDP----
A0A3P9L1F3_MCL1-01      -TSNCGFTGHILGSR--------AGEMSARVPLPSTLASRVANPDP----
A0A3B3IJ04_MCL1-02      -TSNCGFTGHILGSR--------AGEMSARVPLPSTLASHVANPDP----
A0A3P9L1F3_MCL1-02      -TSNCGFTGHILGSR--------AGEMSARVPLPSTLASRVANPDP----
A0A3B3CEX1_MCL1-02      -TPSCGCTALFGG----------AGERSARVPLTSATASRGANPDP----
A0A3B3CEX1_MCL1-01      -TPSCGCTALFGG----------AGERSARVPLTSATASRGANPDP----
A0A3Q3B4P5_MCL1-01      -FLQNGVVDGLHR------------DTSPQVSIGASLGSENGSVAS----
A0A3Q3B4P5_MCL1-02      -FLQNGVVDGLHR------------DTSPQVSIGASLGSENGSVAS----
A0A3Q2EDX8_MCL1-01      -LPQNGVVDGQTHYS--------PEIAAPEIPMNSPMGSLHRN-------
A0A3Q2P7X9_MCL1-01      -ISQNGVGDGQPHYR--------PGLQLPEVEMSSSSEDLRWDC------
A0A3Q2P7X9_MCL1-02      -ISQNGVGDGQPHYR--------PGLQLPEVEMSSSSEDLRWDC------
A0A3B5PQ55_MCL1-02      -FSQNGVGNGQTHYD--------QGLGVPEVAMGSTVESLHSPK------
A0A3B5PQ55_MCL1-01      -FSQNGVGNGQTHYD--------QGLGVPEVAMGSTVESLHSPK------
A0A3P9Q4I8_MCL1-02      -FSQNGVGNGQTHYD--------QGLVVPEVAMGSRVESLHSPM------
A0A3P9Q4I8_MCL1-01      -FSQNGVGNGQTHYD--------QGLVVPEVAMGSRVESLHSPM------
A0A087X830_MCL1-01      -FSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSPK------
A0A3B3YCD0_MCL1-01      -FSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSPK------
I3JHR5_MCL1-01          -LPQNGVLEGPMHYG--------SGKSSPQNATGSSKDSSNGIVS-----
A0A3Q4HLQ8_MCL1-01      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A3P8NP63_MCL1-02      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A3Q2VNL8_MCL1-01      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A3P8NP63_MCL1-01      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A3P9BVM3_MCL1-01      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A3B4G4Z6_MCL1-01      -IPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGIVS-----
A0A2U9CJ81_MCL1-01      -LPQNGVVEGAMHYG--------SGNSLPQIAVGSVIDSRGGNVGA----
A0A3P8VKM5_MCL1-05      -VPQNGVVNGTMHYG--------TGNSTP-IALASSLSTHNDSMSS----
A0A3P8VKM5_MCL1-04      -VPQNGVVNGTMHYG--------TGNSTP-IALASSLSTHNDSMSS----
A0A3P8VKM5_MCL1-03      -VPQNGVVNGTMHYG--------TGNSTP-IALASSLSTHNDSMSS----
A0A3Q3IZW0_MCL1-01      -LPQNGVVEGSMHCG--------S-NTSPQFAVGSSIDSCKGNVGP----
A0A3Q1GX28_MCL1-02      -LPQNGVVE----YS--------SGVNSPQITMSSSIDACNGN-------
A0A3Q1GX28_MCL1-01      -LPQNGVVE----YS--------SGVNSPQITMSSSIDACNGN-------
A0A3B4XKA5_MCL1-01      -CRQNGGLE-TWRDS--------SGDSSPEIAIGSTLCCDNGNVVP----
A0A3Q3GP42_MCL1-01      -MPQNGVGKGQMHYG--------PEASSPQIAMGSSLASQNGNVGS----
A0A3Q3M6G2_MCL1-01      -LPQDGVLEGPVHYD--------SRDPSTQF----TLDSRNGN-GG----
A0A3Q3M6G2_MCL1-02      -LPQDGVLEGPVHYD--------SRDPSTQF----TLDSRNGN-GG----
A0A3B4AFB7_MCL1-01      ----------------------------DTTCLQGVLTPPLGTAHI----
Q8UWD6_MCL1-01          -------------------------MFAGRNNDNGFWPC-----------
A2BF68_MCL1-01          -------------------------MFAGRNNDNGFWPC-----------
Q568W5_MCL1-01          -------------------------MFAGRNNDNGFWPC-----------
A0A3B1K5R1_MCL1-01      ---------MMSPQD--------MCSYNKKTA--DIVPRVAVRGGG----
A0A3B4C6H5_MCL1-01      -----------LFSF--------VWEFSRKWPWNFLWEK-----------
A0A3B4C6H5_MCL1-03      ---------MMMSPK--------EMYFDKKTVFPSLLAKRPFTLGI----
Q568V1_MCL1-01          -FLAQGVQTPTLKTC--------------------VEDELDGYIE-----
Q1L8X3_MCL1-01          -FFAQGVQTPTLKTC--------------------VEDELDGYIE-----
Q9I9N3_MCL1-01          -FFAQGVQTPTLKTC--------------------VEDELDGYTE-----
W5MMB7_MCL1-01          -NATTIHPGLASLGPCPGGSAARTAVLDPMLKADYAEDELDNYSAEPVAT
A0A3B3R4U0_MCL1-01      -GIKNGVKQNGFYSF--------VSASLPVAPLKAKSEEELDSLD-----
A0A3B3SG34_MCL1-01      -PLHHGVLGKSILQC---LDSSARAANTPCLESSGLWDDELDNCTD----
A0A3Q2Y539_MCL1-01      -LPPKAVVQGSMASQ-----------------------------------
Q4SW32_MCL1-01          -MFQNGVGDADLSSS--------------QIPMGSPRDAFNGN-------
D2ITA0_MCL1-03          -SPQNGGEERNMDFHSEGSHTTTEGALPLMATFKS---------------
D2ITA0_MCL1-04          -SPQNGGEERNMDFHSEGSHTTTEGALPLMATFKS---------------
A0A3P9ILF6_MCL1-01      -TSNCGFTGHILGRA---------GEMSARVPLPSTLASRVANPD-----
A0A3P9ILF6_MCL1-02      -TSNCGFTGHILGRA---------GEMSARVPLPSTLASRVANPD-----
Q0KFR9_MCL1-01          -HFQNGGSSYLADDARPLYYFQGAGAICAGASPKSK--VDLGNG------
A0A3P8Y1W8_MCL1-02      -NVQNGVVGSLYSGA-PLCYFSPTGPLCPAASSKSKMDVDLGNG------
A0A3P8Y1W8_MCL1-01      -NVQNGVVGSLYSGA-PLCYFSPTGPLCPAASSKSKMDVDLGNG------
A0A3Q2XZL8_MCL1-01      -RPQNGVAEGLLQCN--------SPPVAAASTSPPQLHRAVATLGAVNCN
A0A3B4AFB7_MCL1-02      -LPQNGLAEGDMHCG--------AADSSAQMPRPATMDTRKGNTA-----
A0A3B3VM25_MCL1-01      -FSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSP-------
A0A3Q0R633_MCL1-01      ----------SLPF--------------------TSPDS-----------
A0A3Q0R633_MCL1-03      -LPQNGVVDGTMHYG--------SGNSSPQDATGTPKDS-----------
A0A3B4T8L9_MCL1-02      -CRQNGGLETWTD-G--------SGDSSPEIAIGSTICSHNGNVV-----
A0A3B4T8L9_MCL1-01      -CRQNGGLETWTD-G--------SGDSSPEIAIGSTICSHNGNVV-----
A0A3Q1EQB9_MCL1-02      -FPQNGVVEGPMHYG--------SGDSSPQISVASSIDPQNGNLG-----
A0A3B4ZKP6_MCL1-01      -LPQNGVVEGQMHYG--------SGDPSAQIPMASPLDSHNGNVG-----
A0A3Q1BKL8_MCL1-02      -FPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG-----
A0A3Q1EQB9_MCL1-01      -FPQNGVVEGPMHYG--------SGDSSPQISVASSIDPQNGNLG-----
A0A3Q1BKL8_MCL1-01      -FPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG-----
A0A3P8RQX7_MCL1-01      -FPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG-----
A0A3P8RQX7_MCL1-02      -FPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG-----
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          ------------------APPSPISGRGPRRHRDPSRGGCLRPLAVRGCP
Q9Z1P3_MCL1-01          ---------ALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPP
A5PJR2_MCL1-01          ----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPP
A0A452GA25_MCL1-01      ----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPP
G1L3L7_MCL1-01          ----ASPPX---------------GAEGPDVTATPPRLLFLEPTRRASPP
G1T2Q0_MCL1-01          ----ASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASPL
F7AVA6_MCL1-01          ----GSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFAPTRCASPP
A0A337S3J9_MCL1-01      ----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPP
A0A337S3J9_MCL1-03      ----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPP
Q7YRZ9_MCL1-01          ----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPP
F1PAP1_MCL1-01          ----ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPP
Q8HYS5_MCL1-01          ----ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPP
M3XZZ5_MCL1-01          ----ASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTHRASPP
A0A452RHX5_MCL1-01      ----ASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASPP
H0XFB7_MCL1-01          ----ASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLRAAPR
F7GTF7_MCL1-01          ----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPL
A0A2K5CFH3_MCL1-01      ----ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPL
A0A2K6V5Y3_MCL1-01      ----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPL
A0A2K6KRW9_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPL
A0A2K5XSB2_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPL
A0A0D9RZP5_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
I7G687_MCL1-01          ----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAPL
A0A2K5LXU8_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
A0A2I3GJZ3_MCL1-02      ----ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPL
H2N5Y9_MCL1-01          ----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPL
A0A2R9BPJ5_MCL1-01      ----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
A0A2I3RTV4_MCL1-01      ----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
A0A2I2YQH7_MCL1-01      ----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
A0A2K5C7L5_MCL1-01      ----ASPSAALTPDAR----------------GSCGRCWFFAPTRRAAPL
A0A2K5I9I0_MCL1-02      ----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPL
A0A2K6GI15_MCL1-01      ----ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRRALPS
A0A2I3GJZ3_MCL1-01      ----ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPL
A0A2K5CFH3_MCL1-03      ----ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPL
A0A2K5R5E2_MCL1-03      ----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPL
A0A2K5W0W9_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPL
A0A2K6ECR0_MCL1-02      ----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPL
A0A2I3LFM0_MCL1-01      ----ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPL
A0A2K6KRW9_MCL1-02      ----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPL
A0A2K6PPI3_MCL1-02      ----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPL
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          ------------------------------DVTAPPRPFFFAPGGRCSPP
W5QI41_MCL1-01          -----------------------------------------------GSR
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          ---------------------------------MFGLKRNAVIGLNLYCG
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          ------------------------------------------------LP
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          WSAGASPQATLARDPGRVARPSPMGTEGPDGTAAPARWLFSPISRNC--P
H9GEA6_MCL1-02          ----PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGE
H9GEA6_MCL1-01          ----PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGE
A0A493U0E8_MCL1-01      QGPARIDHFGSVPWNSEASPRGVVGTAHFGSVLWN---------------
A0A1L1RNM6_MCL1-01      EAP-------RAPIGSGAAPHAPIGSAAARRAPPD---------------
A0A1L1RNM6_MCL1-02      EAP-------RAPIGSGAAPHAPIGSAAARRAPPD---------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          GGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAP
F6ZMX1_MCL1-03          GGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAP
F6ZMX1_MCL1-02          GGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAP
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          ---------------------------GSGGATRPGGRLL---------A
A0A287DCH9_MCL1-02      ----------------------------PDVTATPARRLFFAPTYCVSPP
P97287_MCL1-01          --------AALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPP
A0A452GA25_MCL1-02      ----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPP
A0A287DCH9_MCL1-01      --------AAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPP
G3T756_MCL1-01          ----ASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPP
A0A1S3F3I1_MCL1-01      ----ASPSTTLAPDARRVARPAPIGAEVPDVTGTPTKRVFFAPTHRAPTP
G1L3L7_MCL1-02          ----ASPPAXXX--XXXXXXXXXXGAEGPDVTATPPRLLFLEPTRRASPP
A0A287BK44_MCL1-01      ----ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPP
A0A287BK44_MCL1-02      ----ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPP
A0A3B1IEV7_MCL1-01      LEG-------LQSAKG----------------------------------
A0A3B4CGU9_MCL1-03      LEG-------LQAAPGPAS-------------------------------
A0A3B4CGU9_MCL1-02      FGGPVTLIYLIHGGQGGSS-------------------------------
A0A3Q3VP02_MCL1-01      -NDTSKRPNLLVVNPTKE--------------------------------
A0A3B5K5B3_MCL1-01      -NDSPKRPSKLSVIAPKV--------------------------------
A0A3B3IJ04_MCL1-01      -SDQLKRPQDLE--------------------------------------
A0A3P9L1F3_MCL1-01      -SDQLKRPQDLE--------------------------------------
A0A3B3IJ04_MCL1-02      -SDQLKRPQDLE--------------------------------------
A0A3P9L1F3_MCL1-02      -SDQLKRPQDLE--------------------------------------
A0A3B3CEX1_MCL1-02      -SEQMKRPQDLDMLGNKSP-------------------------------
A0A3B3CEX1_MCL1-01      -SEQMKRPQDLDMLGNKSP-------------------------------
A0A3Q3B4P5_MCL1-01      -CNSSKRPKDLVMPPLKG--------------------------------
A0A3Q3B4P5_MCL1-02      -CNSSKRPKDLVMPPLKG--------------------------------
A0A3Q2EDX8_MCL1-01      ---LMKRPKDLQV-ATNG--------------------------------
A0A3Q2P7X9_MCL1-01      -S---KRPKNLRVMARNG--------------------------------
A0A3Q2P7X9_MCL1-02      -S---KRPKNLRVMARNG--------------------------------
A0A3B5PQ55_MCL1-02      -DPFMKRPTNLGV---NG--------------------------------
A0A3B5PQ55_MCL1-01      -DPFMKRPTNLGV---NG--------------------------------
A0A3P9Q4I8_MCL1-02      -DPFKKRPTNLAVTASNG--------------------------------
A0A3P9Q4I8_MCL1-01      -DPFKKRPTNLAVTASNG--------------------------------
A0A087X830_MCL1-01      -DPYKKRPTNLAVSASNG--------------------------------
A0A3B3YCD0_MCL1-01      -DPYKQRPTNLAVTASNG--------------------------------
I3JHR5_MCL1-01          -NGTPKRPNNLGVTSTNG--------------------------------
A0A3Q4HLQ8_MCL1-01      -NGTPKRPDNLEVTSTNG--------------------------------
A0A3P8NP63_MCL1-02      -NGTPKRPDNLEVTSTNG--------------------------------
A0A3Q2VNL8_MCL1-01      -NGTPKRPDNLEVTSTNG--------------------------------
A0A3P8NP63_MCL1-01      -NGTPKRPDNLEVTSTNG--------------------------------
A0A3P9BVM3_MCL1-01      -NGTPKRPDNLEVTSTNG--------------------------------
A0A3B4G4Z6_MCL1-01      -NGTPKRPDNLEVTSTNG--------------------------------
A0A2U9CJ81_MCL1-01      -GDAPKRPKNLQVSATKA--------------------------------
A0A3P8VKM5_MCL1-05      VTETQRRPKDLQVNTANG--------------------------------
A0A3P8VKM5_MCL1-04      VTETQRRPKDLQVNTANG--------------------------------
A0A3P8VKM5_MCL1-03      VTETQRRPKDLQVNTANG--------------------------------
A0A3Q3IZW0_MCL1-01      -NNTLKRPKILDVSSTNG--------------------------------
A0A3Q1GX28_MCL1-02      --AALKRPKNLDVSSSNG--------------------------------
A0A3Q1GX28_MCL1-01      --AALKRPKNLDVSSSNG--------------------------------
A0A3B4XKA5_MCL1-01      -NDNSKRPKSLEVTSTNG--------------------------------
A0A3Q3GP42_MCL1-01      -NETTKRPKALVVNSGN---------------------------------
A0A3Q3M6G2_MCL1-01      -TANPKRPKNLEVSSTNG--------------------------------
A0A3Q3M6G2_MCL1-02      -TANPKRPKNLEVSSTNG--------------------------------
A0A3B4AFB7_MCL1-01      CGSPHPRPTALVMKNELLN-------------------------------
Q8UWD6_MCL1-01          TGLQSKPLVIPELKA-----------------------------------
A2BF68_MCL1-01          TGLQSKPLVIPELKA-----------------------------------
Q568W5_MCL1-01          TGLQSKPLVIPELKA-----------------------------------
A0A3B1K5R1_MCL1-01      GGAGLSLGLAADIRP-----------------------------------
A0A3B4C6H5_MCL1-01      -------LIAA---------------------------------------
A0A3B4C6H5_MCL1-03      SSQTRAPRIAA---------------------------------------
Q568V1_MCL1-01          EEEAPLKRLRPGTNGLKG--------------------------------
Q1L8X3_MCL1-01          EEEAPLKRLRPGTNGLKG--------------------------------
Q9I9N3_MCL1-01          EEEAPLKRLRPGTNGLKG--------------------------------
W5MMB7_MCL1-01          SAWIPKSPRSLPAGLKLG--------------------------------
A0A3B3R4U0_MCL1-01      EGERFHGAPKTERRDCEH--------------------------------
A0A3B3SG34_MCL1-01      EVDVCPCSTRLAKRDSEK--------------------------------
A0A3Q2Y539_MCL1-01      LQEVERRSDNSD--------------------------------------
Q4SW32_MCL1-01          VGDSPKRPSKLTVVKPKV--------------------------------
D2ITA0_MCL1-03          GDERKPRPTELG----RG--------------------------------
D2ITA0_MCL1-04          GDERKPRPTELG----RG--------------------------------
A0A3P9ILF6_MCL1-01      PSDQFKRPQDLEYSARRF--------------------------------
A0A3P9ILF6_MCL1-02      PSDQFKRPQDLEYSARRF--------------------------------
Q0KFR9_MCL1-01          TGDTPPRPTTLGVNVVKS--------------------------------
A0A3P8Y1W8_MCL1-02      TADTPVRPTKLEVNMTKP--------------------------------
A0A3P8Y1W8_MCL1-01      TADTPVRPTKLEVNMTKP--------------------------------
A0A3Q2XZL8_MCL1-01      SGAAKPRPSALEILCKGG--------------------------------
A0A3B4AFB7_MCL1-02      SSGSP-HPRPTALVMKNE--------------------------------
A0A3B3VM25_MCL1-01      KDPYKQRPTNLAVTASNG--------------------------------
A0A3Q0R633_MCL1-01      -NGTPKRPNNLGVVSTNG--------------------------------
A0A3Q0R633_MCL1-03      -NGTPKRPNNLGVVSTNG--------------------------------
A0A3B4T8L9_MCL1-02      PNDNSKRPKSLEVTSTNG--------------------------------
A0A3B4T8L9_MCL1-01      PNDNSKRPKSLEVTSTNG--------------------------------
A0A3Q1EQB9_MCL1-02      SSDTPKRPKNLGV---NG--------------------------------
A0A3B4ZKP6_MCL1-01      SGATPKRPKNLGVSTTNG--------------------------------
A0A3Q1BKL8_MCL1-02      SNETPKRPKNLGV---NG--------------------------------
A0A3Q1EQB9_MCL1-01      SSDTPKRPKNLGV---NG--------------------------------
A0A3Q1BKL8_MCL1-01      SNETPKRPKNLGV---NG--------------------------------
A0A3P8RQX7_MCL1-01      SSETPKRPKNLGV---NG--------------------------------
A0A3P8RQX7_MCL1-02      SSETPKRPKNLGV---NG--------------------------------
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -----PSPQSELDEDEDYMDVQSDSRG-----------------------
G1PZ39_MCL1-01          RRWKAAAADAIMSPEEELDGYEPEPLG----------------------K
Q9Z1P3_MCL1-01          EEMAASAA-AIMSPEEELDGCEPEVLS----------------------K
A5PJR2_MCL1-01          EEMESPISDAIMSPEEELDGCEPDPLG----------------------K
A0A452GA25_MCL1-01      EEMESPISDAIMSPEEELDGCEPDPLG----------------------K
G1L3L7_MCL1-01          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
G1T2Q0_MCL1-01          EEMEAPAADAIMSPEEELDGYEPEPLA----------------------K
F7AVA6_MCL1-01          EGMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A337S3J9_MCL1-01      EKMEGPAADAIMSPEEELDGYEPEPLG----------------------K
A0A337S3J9_MCL1-03      EKMEGPAADAIMSPEEELDGYEPEPLG----------------------K
Q7YRZ9_MCL1-01          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
F1PAP1_MCL1-01          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
Q8HYS5_MCL1-01          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
M3XZZ5_MCL1-01          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
A0A452RHX5_MCL1-01      EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
H0XFB7_MCL1-01          EEMEAPAADAIMSPEDELDGYEPEPLG----------------------K
F7GTF7_MCL1-01          EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5CFH3_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K6V5Y3_MCL1-01      EEMEAPAADAIMSPEDELDGYEPEPLG----------------------K
A0A2K6KRW9_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5XSB2_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A0D9RZP5_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
I7G687_MCL1-01          EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5LXU8_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2I3GJZ3_MCL1-02      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
H2N5Y9_MCL1-01          EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2R9BPJ5_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2I3RTV4_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2I2YQH7_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5C7L5_MCL1-01      EEMEAPAADAIMSPEEELDRYEPEPLG----------------------K
A0A2K5I9I0_MCL1-02      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K6GI15_MCL1-01      EEMEAPAADAIMSPEDELDGYEPEPLG----------------------K
A0A2I3GJZ3_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5CFH3_MCL1-03      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5R5E2_MCL1-03      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K5W0W9_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K6ECR0_MCL1-02      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2I3LFM0_MCL1-01      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K6KRW9_MCL1-02      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A2K6PPI3_MCL1-02      EEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          AEVADGAADAILSPEDELDGYEPELPG----------------------K
W5QI41_MCL1-01          KPRPAPGPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMFGFKR
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          GAGLGAGSGGATRPGGRLLATEKEASA----------------------R
B4DG83_MCL1-01          --MEAPAADAIMSPEEELDGYEPEPLG----------------------K
B4E3L8_MCL1-01          --MEAPAADAIMSPEEELDGYEPEPLG----------------------K
B6V6J0_MCL1-01          --------------DPDMDTHRPQLNG----------------------L
G3PJT0_MCL1-01          ---------------NSANGYPSKPQR----------------------E
H0XHA5_MCL1-01          DQMEAQVADAVKSPEGEVASCEPEPLK----------------------K
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          EELGALAADAIMSPGEELGRYEPEP------------------------K
H9GEA6_MCL1-02          GEQPKWRPASLPLPEGELDGCEEAEEE----------------------E
H9GEA6_MCL1-01          GEQPKWRPASLPLPEGELDGCEEAEEE----------------------E
A0A493U0E8_MCL1-01      ---SEASPWG-WGGTDHFGAVFPEPSS----------------------G
A0A1L1RNM6_MCL1-01      ---STSRPVALWSPEEELDGCEPESER----------------------G
A0A1L1RNM6_MCL1-02      ---STSRPVALWSPEEELDGCEPESER----------------------G
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          AEVADGAADVPMCPEEELDGYEPEPPG----------------------K
F6ZMX1_MCL1-03          AEVADGAADVPMCPEEELDGYEPEPPG----------------------K
F6ZMX1_MCL1-02          AEVADGAADVPMCPEEELDGYEPEPPG----------------------K
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      -----------MSPEEELDGYEPEPLG----------------------K
B4DU51_MCL1-01          TEMEAPAADAIMSPEEELDGYEPEPLG----------------------K
A0A287DCH9_MCL1-02      EKMEAPAAA--MSPEEELDGYEPEPLG----------------------K
P97287_MCL1-01          EEMAASAAAAIVSPEEELDGCEPEAIG----------------------K
A0A452GA25_MCL1-02      EEMESPISDAIMSPEEELDGCEPDPLG----------------------K
A0A287DCH9_MCL1-01      EKMEAPA--AAMSPEEELDGYEPEPLG----------------------K
G3T756_MCL1-01          VEMEALAADAIMSPEEELDGYEPEPLG----------------------K
A0A1S3F3I1_MCL1-01      DEMEAAAAGAIMSPEEELDGYEPEPLG----------------------K
G1L3L7_MCL1-02          EEMEGPAADAIMSPEEELDGYEPEPLG----------------------K
A0A287BK44_MCL1-01      EEMESPASDAIMSPEEELDGYEPEPLG----------------------K
A0A287BK44_MCL1-02      EEMESPASDAIMSPEEELDGYEPEPLG----------------------K
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      -------------------------------------------------Y
A0A3B5K5B3_MCL1-01      -------------------------------------------------C
A0A3B3IJ04_MCL1-01      -------------------------------------------------Y
A0A3P9L1F3_MCL1-01      -------------------------------------------------Y
A0A3B3IJ04_MCL1-02      -------------------------------------------------Y
A0A3P9L1F3_MCL1-02      -------------------------------------------------Y
A0A3B3CEX1_MCL1-02      -------------------------------------------------Y
A0A3B3CEX1_MCL1-01      -------------------------------------------------Y
A0A3Q3B4P5_MCL1-01      -------------------------------------------------Y
A0A3Q3B4P5_MCL1-02      -------------------------------------------------Y
A0A3Q2EDX8_MCL1-01      -------------------------------------------------Y
A0A3Q2P7X9_MCL1-01      -------------------------------------------------F
A0A3Q2P7X9_MCL1-02      -------------------------------------------------F
A0A3B5PQ55_MCL1-02      -------------------------------------------------Y
A0A3B5PQ55_MCL1-01      -------------------------------------------------Y
A0A3P9Q4I8_MCL1-02      -------------------------------------------------Y
A0A3P9Q4I8_MCL1-01      -------------------------------------------------Y
A0A087X830_MCL1-01      -------------------------------------------------Y
A0A3B3YCD0_MCL1-01      -------------------------------------------------Y
I3JHR5_MCL1-01          -------------------------------------------------Y
A0A3Q4HLQ8_MCL1-01      -------------------------------------------------Y
A0A3P8NP63_MCL1-02      -------------------------------------------------Y
A0A3Q2VNL8_MCL1-01      -------------------------------------------------Y
A0A3P8NP63_MCL1-01      -------------------------------------------------Y
A0A3P9BVM3_MCL1-01      -------------------------------------------------Y
A0A3B4G4Z6_MCL1-01      -------------------------------------------------Y
A0A2U9CJ81_MCL1-01      -------------------------------------------------Y
A0A3P8VKM5_MCL1-05      -------------------------------------------------H
A0A3P8VKM5_MCL1-04      -------------------------------------------------H
A0A3P8VKM5_MCL1-03      -------------------------------------------------H
A0A3Q3IZW0_MCL1-01      -------------------------------------------------Y
A0A3Q1GX28_MCL1-02      -------------------------------------------------Y
A0A3Q1GX28_MCL1-01      -------------------------------------------------Y
A0A3B4XKA5_MCL1-01      -------------------------------------------------Y
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      -------------------------------------------------Y
A0A3Q3M6G2_MCL1-02      -------------------------------------------------Y
A0A3B4AFB7_MCL1-01      -------------------------------------------------K
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          -------------------------------------------------L
Q1L8X3_MCL1-01          -------------------------------------------------L
Q9I9N3_MCL1-01          -------------------------------------------------L
W5MMB7_MCL1-01          -------------------------------------------------G
A0A3B3R4U0_MCL1-01      -------------------------------------------------H
A0A3B3SG34_MCL1-01      -------------------------------------------------E
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          -------------------------------------------------C
D2ITA0_MCL1-03          -------------------------------------------------R
D2ITA0_MCL1-04          -------------------------------------------------R
A0A3P9ILF6_MCL1-01      -------------------------------------------------H
A0A3P9ILF6_MCL1-02      -------------------------------------------------H
Q0KFR9_MCL1-01          -------------------------------------------------N
A0A3P8Y1W8_MCL1-02      -------------------------------------------------N
A0A3P8Y1W8_MCL1-01      -------------------------------------------------N
A0A3Q2XZL8_MCL1-01      -------------------------------------------------L
A0A3B4AFB7_MCL1-02      -------------------------------------------------L
A0A3B3VM25_MCL1-01      -------------------------------------------------Y
A0A3Q0R633_MCL1-01      -------------------------------------------------Y
A0A3Q0R633_MCL1-03      -------------------------------------------------Y
A0A3B4T8L9_MCL1-02      -------------------------------------------------Y
A0A3B4T8L9_MCL1-01      -------------------------------------------------Y
A0A3Q1EQB9_MCL1-02      -------------------------------------------------Y
A0A3B4ZKP6_MCL1-01      -------------------------------------------------F
A0A3Q1BKL8_MCL1-02      -------------------------------------------------Y
A0A3Q1EQB9_MCL1-01      -------------------------------------------------Y
A0A3Q1BKL8_MCL1-01      -------------------------------------------------Y
A0A3P8RQX7_MCL1-01      -------------------------------------------------Y
A0A3P8RQX7_MCL1-02      -------------------------------------------------Y
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -------------------------PSTPEDGDG----D-----------
H3AR18_MCL1-01          ----------------------MELPGDGCPQDG----D-----------
J7H260_MCL1-01          --------------------------STSPPLTPTC--S-----------
G1PZ39_MCL1-01          RPAVLPLVQLVGEASGG-PGAGGSLPSTPPPAEE----E-----------
Q9Z1P3_MCL1-01          RPAVLPLLERVSEAAKS-SGADGSLPSTPPPPEE----E-----------
A5PJR2_MCL1-01          RPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEE----E-----------
A0A452GA25_MCL1-01      RPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEE----E-----------
G1L3L7_MCL1-01          RPAVLPLLELVGEASGG-PCTDGSLPSTPPPAEE----E-----------
G1T2Q0_MCL1-01          RPAVLPLLDLVGEASKV-PSTDGSLPSTPPPAEE----E-----------
F7AVA6_MCL1-01          RPAVLPLLEFVREASSG-PCTDGSLPSTPPPAEE----E-----------
A0A337S3J9_MCL1-01      RPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE----E-----------
A0A337S3J9_MCL1-03      RPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE----E-----------
Q7YRZ9_MCL1-01          RPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE----E-----------
F1PAP1_MCL1-01          RPAVLPLLELVGEASSG-PGMDGSLPSTPPPAEE----E-----------
Q8HYS5_MCL1-01          RPAVLPLLELVGEASSG-PGMDGSLPSTPPPAEE----E-----------
M3XZZ5_MCL1-01          RPAVLPLLELVGEASSG-PCTDGSLPSTPPPAEE----E-----------
A0A452RHX5_MCL1-01      RPAVLPLLELVGEASGG-PCTDGSLPSTPPPAEE----E-----------
H0XFB7_MCL1-01          RPAVLPLLELVGEASNG-PSTDGSLPSTPPPAEE----E-----------
F7GTF7_MCL1-01          RPAVLPLLELVGEPANG-SSTDGSLPSTPPPAEE----E-----------
A0A2K5CFH3_MCL1-01      RPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE----E-----------
A0A2K6V5Y3_MCL1-01      RPAVLPLLELVGEPGHG-SSTDGSLPSTPPPAEE----E-----------
A0A2K6KRW9_MCL1-01      RPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE----E-----------
A0A2K5XSB2_MCL1-01      RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A0D9RZP5_MCL1-01      RPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE----E-----------
I7G687_MCL1-01          RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A2K5LXU8_MCL1-01      RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A2I3GJZ3_MCL1-02      RPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE----E-----------
H2N5Y9_MCL1-01          RPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE----E-----------
A0A2R9BPJ5_MCL1-01      RPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE----E-----------
A0A2I3RTV4_MCL1-01      RPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE----E-----------
A0A2I2YQH7_MCL1-01      RPAVLPLLELVGESGND-TSTDGSLPSTPPPAEE----E-----------
A0A2K5C7L5_MCL1-01      RPAVLPLLELVEEPGND-SSTDGSLPSTPP--------------------
A0A2K5I9I0_MCL1-02      RPAVLPLLELVGES-NS-SSTDGSLPSTPPPAEE----E-----------
A0A2K6GI15_MCL1-01      RPAVLPLLELVGEASNG-SSTDGSLPSTPPPAEE----E-----------
A0A2I3GJZ3_MCL1-01      RPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE----E-----------
A0A2K5CFH3_MCL1-03      RPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE----E-----------
A0A2K5R5E2_MCL1-03      RPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE----E-----------
A0A2K5W0W9_MCL1-01      RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A2K6ECR0_MCL1-02      RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A2I3LFM0_MCL1-01      RPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE----E-----------
A0A2K6KRW9_MCL1-02      RPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE----E-----------
A0A2K6PPI3_MCL1-02      RPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE----E-----------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          RPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEE-----------
W5QI41_MCL1-01          RPAVRPLPLMVGEASNNSPGSDGSLPSTPPPSEE----E-----------
F1MQX4_MCL1-01          -------------------------GMLPIFSEE----E-----------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          RE--------IGGGEAGAV-IGGSAGASPPSTLT----P-----------
B4DG83_MCL1-01          RPAVLPLLELVGESGNNTS-TDGSLPSTPPPAEE----E-----------
B4E3L8_MCL1-01          RPAVLPLLELVGESGNNTS-TDGSLPSTPPPAEE----E-----------
B6V6J0_MCL1-01          GFNNGGSLPCSQEDELDEDMDNGSQGSTSPPDSPVC--P-----------
G3PJT0_MCL1-01          DSEDTDNDSLPCTPESDSETDVSDSPAGAAA-------------------
H0XHA5_MCL1-01          QPEGLPLLEFVGEA--GNGPSTDTLPSTPPPAEEED--E-----------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          QPAVLPLLQLVGEA--SEGPAGGSLPSTPPPAEEEE--E-----------
H9GEA6_MCL1-02          AATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDH-----------------
H9GEA6_MCL1-01          AATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDH-----------------
A0A493U0E8_MCL1-01      ----------------IFSRPARTNPLGSAP-------------------
A0A1L1RNM6_MCL1-01      --------------------PGGDSLPGTPPELPDL--I-----------
A0A1L1RNM6_MCL1-02      --------------------PGGDSLPGTPPELPDL--I-----------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          RPSRLAVLEIARE---GGDSPNGSLPSTPPPAEEDE--E-----------
F6ZMX1_MCL1-03          RPSRLAVLEIARE---GGDSPNGSLPSTPPPAEEDE--E-----------
F6ZMX1_MCL1-02          RPSRLAVLEIARE---GGDSPNGSLPSTPPPAEEDE--E-----------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      RPAVLPLLGLVGEAG-KSPSADGSLPSTPPPAEEEE--E-----------
B4DU51_MCL1-01          RPAVLPLLELVGESG-NNTSTDGSLPLTPPPAEEEE--D-----------
A0A287DCH9_MCL1-02      RPAVLPLLELVGEAA-KSPGADGSLPSTPPPAEEED--D-----------
P97287_MCL1-01          RPAVLPLLERVSEAA-KSSGADGSLPSTPPPPEEEE--D-----------
A0A452GA25_MCL1-02      RPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEEEE--D-----------
A0A287DCH9_MCL1-01      RPAVLPLLELVGEAA-KSPGADGSLPSTPPPAEEED--D-----------
G3T756_MCL1-01          RPAVFPRLGLVGEAS-NGPGTDGSLPSTPPLAEEEE--D-----------
A0A1S3F3I1_MCL1-01      RPAVLPLLELVGEAS-KSSRTDGSLPSTPPPAEEED--D-----------
G1L3L7_MCL1-02          RPAVLPLLELVGEAS-GGPCTDGSLPSTPPPAEEEE--D-----------
A0A287BK44_MCL1-01      RPAVLPLLGLVEEAS-SGPGTDGSLPSTPPPAEEEE--D-----------
A0A287BK44_MCL1-02      RPAVLPLLGLVEEAS-SGPGTDGSLPSTPPPAEEEE--D-----------
A0A3B1IEV7_MCL1-01      ------------VS-----MGGGSLPDSPLADVDFIQDF-----------
A0A3B4CGU9_MCL1-03      -----------KAA-----MAGGSLPESPESD-DFVPDF-----------
A0A3B4CGU9_MCL1-02      -----------SSS-----AQTGS-PAAPELT-HVQVNSISISSTKEQTT
A0A3Q3VP02_MCL1-01      MGKPIRKDS--TDT-----DDDGSLPYTPDMSPDSELNV-----------
A0A3B5K5B3_MCL1-01      VAKAIQEDS--QDT-----DHRSA-PCTPEMNSVNGLDV-----------
A0A3B3IJ04_MCL1-01      SARRF------HDV-----DDDGSLPNTPELECE--ASV-----------
A0A3P9L1F3_MCL1-01      SARRF------HDV-----DDDGSLPNTPELECE--ASV-----------
A0A3B3IJ04_MCL1-02      SARRF------HDV-----DDDGSLPNTPELECE--ASV-----------
A0A3P9L1F3_MCL1-02      SARRF------HDV-----DDDGSLPNTPELECE--ASV-----------
A0A3B3CEX1_MCL1-02      AARRF------HD------DDGGSLPNTPELECD--NSV-----------
A0A3B3CEX1_MCL1-01      AARRF------HD------DDGGSLPNTPELECD--NSV-----------
A0A3Q3B4P5_MCL1-01      QDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG-----------
A0A3Q3B4P5_MCL1-02      QDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG-----------
A0A3Q2EDX8_MCL1-01      VGKNLSDN---SAD------DGGSLPCTPEMPTDSHPAT-----------
A0A3Q2P7X9_MCL1-01      AVKSIQEN---RDD--------GSLPSTPEMQADSEAAG-----------
A0A3Q2P7X9_MCL1-02      AVKSIQEN---RDD--------GSLPSTPEMQADSEAAG-----------
A0A3B5PQ55_MCL1-02      VAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDA-----------
A0A3B5PQ55_MCL1-01      VAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDA-----------
A0A3P9Q4I8_MCL1-02      VAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDA-----------
A0A3P9Q4I8_MCL1-01      VAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDA-----------
A0A087X830_MCL1-01      VAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDA-----------
A0A3B3YCD0_MCL1-01      VAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDA-----------
I3JHR5_MCL1-01          TTKAI------RDR-----EEDGSLPSTPEYHLD----------------
A0A3Q4HLQ8_MCL1-01      TTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A3P8NP63_MCL1-02      KTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A3Q2VNL8_MCL1-01      KTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A3P8NP63_MCL1-01      KTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A3P9BVM3_MCL1-01      KTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A3B4G4Z6_MCL1-01      KTKAI------RDR-----EEDGSLPSTPEFHSD----------------
A0A2U9CJ81_MCL1-01      AAKSCREDGGGGGD-----VGGGSLPSTPESDGE--HDV-----------
A0A3P8VKM5_MCL1-05      ARKSH-------CE-----VDEGSEPCTPEPHSE--AEL-----------
A0A3P8VKM5_MCL1-04      ARKSH-------CE-----VDEGSEPCTPEPHSE--AEL-----------
A0A3P8VKM5_MCL1-03      ARKSH-------CE-----VDEGSEPCTPEPHSE--AEL-----------
A0A3Q3IZW0_MCL1-01      GTKTL-VD---VSD-----IDNGSLPCSPVLQPDNEIEV-----------
A0A3Q1GX28_MCL1-02      ATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDV-----------
A0A3Q1GX28_MCL1-01      ATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDV-----------
A0A3B4XKA5_MCL1-01      ATKASRED----SD-----VDDGSLPCTPEMQSDGETDV-----------
A0A3Q3GP42_MCL1-01      ------------DD-----IEDGSLPCTPEPDSE--TEV-----------
A0A3Q3M6G2_MCL1-01      ATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEA-----------
A0A3Q3M6G2_MCL1-02      ATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEA-----------
A0A3B4AFB7_MCL1-01      NTREE------DYE-----NSEGSLPCTPEFHSDSEMEL-----------
Q8UWD6_MCL1-01          -HNQF------AVD-----SLQGSVPSSPS--DETGDYP-----------
A2BF68_MCL1-01          -HNQF------AVD-----SLQGSVPSSPS--DETGDYP-----------
Q568W5_MCL1-01          -HNQF------AVD-----SLQGSVPSSPS--DETGDYP-----------
A0A3B1K5R1_MCL1-01      -TRPG------VDD--------GSVPSSPL--SDCGEMA-----------
A0A3B4C6H5_MCL1-01      -----------VTD--------GSLPTSPA--SDCEELD-----------
A0A3B4C6H5_MCL1-03      -----------VTD--------GSLPTSPA--SDCEELD-----------
Q568V1_MCL1-01          QLDGRFVS-----------TTDGSLPTTPDPEELDYA-------------
Q1L8X3_MCL1-01          QLDGRFVS-----------ATDGSLPTTPDPEELDYA-------------
Q9I9N3_MCL1-01          QLDGRFVS-----------ATDGSLPTTPDPEELDYA-------------
W5MMB7_MCL1-01          HFPESG-------------HADGSLPSTPDTPLDCGSVP-----------
A0A3B3R4U0_MCL1-01      LRASG--------------NEDGSLPSTPGTPPDCGKML-----------
A0A3B3SG34_MCL1-01      PCRGSRLP---GST-----NAVGSLPTSPDGDLPAYGPI-----------
A0A3Q2Y539_MCL1-01      -------------------MDEGAQP-LPELQT-----------------
Q4SW32_MCL1-01          LSKTIQED-----------SEDGSLPCTPESHSGDVLDV-----------
D2ITA0_MCL1-03          LVNKSQDD---QEG-------NGSLPSTPELQSEVDTD------------
D2ITA0_MCL1-04          LVNKSQDD---QEG-------NGSLPSTPELQSEVDTD------------
A0A3P9ILF6_MCL1-01      DV-----------------DDDGSLPNTPEL--ECEASV-----------
A0A3P9ILF6_MCL1-02      DV-----------------DDDGSLPNTPEL--ECEASV-----------
Q0KFR9_MCL1-01          GLDNHLSD---RSN-----N-DDSLPCTPQMASECGPEL-----------
A0A3P8Y1W8_MCL1-02      VLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGL-----------
A0A3P8Y1W8_MCL1-01      VLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGL-----------
A0A3Q2XZL8_MCL1-01      ATMNHRNN---SDDDFDVESSDDSPPSTPDSQDSLVAD------------
A0A3B4AFB7_MCL1-02      LNKNTREE---DYE-----NSEGSLPCTPEFHSDSEMEL-----------
A0A3B3VM25_MCL1-01      VAKSLQES---SD--------EGSLPCTPA-QQDSETVA-----------
A0A3Q0R633_MCL1-01      APKNI------TDD-----VEDGSLPSTPEFHSDSES-------------
A0A3Q0R633_MCL1-03      APKNI------TDD-----VEDGSLPSTPEFHSDSES-------------
A0A3B4T8L9_MCL1-02      ATKASRED---SD------VDDGSLPCTPEIQSDGETDV-----------
A0A3B4T8L9_MCL1-01      ATKASRED---SD------VDDGSLPCTPEIQSDGETDV-----------
A0A3Q1EQB9_MCL1-02      APKSLRQD---SDS-----MEDGSLPCTPELQSDSETDV-----------
A0A3B4ZKP6_MCL1-01      AGKGLRQV---SDS-----LEDSSLPCTPELQSDSETDV-----------
A0A3Q1BKL8_MCL1-02      ASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV-----------
A0A3Q1EQB9_MCL1-01      APKSLRQD---SDS-----MEDGSLPCTPELQSDSETDV-----------
A0A3Q1BKL8_MCL1-01      ASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV-----------
A0A3P8RQX7_MCL1-01      ASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV-----------
A0A3P8RQX7_MCL1-02      ASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV-----------
                                                                          

I3KXG5_MCL1-01          ----------------------LERETKLIIHSFL---------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      ----------------------LENDTRQLICDFL---------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -------------------MAEFRKETLKLLRSYL---------------
H3AR18_MCL1-01          -------------------MAEFRKETLKLLRSYL---------------
J7H260_MCL1-01          -------------------PDPLHTETRALLHTFF---------------
G1PZ39_MCL1-01          -------------------EDELFRQSLEIISRY----------------
Q9Z1P3_MCL1-01          -------------------DDELYHQSLEIISRYL---------------
A5PJR2_MCL1-01          -------------------EDELYRQSLEIISQYL---------------
A0A452GA25_MCL1-01      -------------------EDELYRQSLEIISQYL---------------
G1L3L7_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
G1T2Q0_MCL1-01          -------------------EDELYRQSLEIIARYL---------------
F7AVA6_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
A0A337S3J9_MCL1-01      -------------------EDELFRQSLEIISRYL---------------
A0A337S3J9_MCL1-03      -------------------EDELFRQSLEIISRYL---------------
Q7YRZ9_MCL1-01          -------------------EDELFRQSLEIISRYL---------------
F1PAP1_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
Q8HYS5_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
M3XZZ5_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
A0A452RHX5_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
H0XFB7_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
F7GTF7_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
A0A2K5CFH3_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K6V5Y3_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K6KRW9_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K5XSB2_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A0D9RZP5_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
I7G687_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
A0A2K5LXU8_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2I3GJZ3_MCL1-02      -------------------EDELYRQSLEIISRYL---------------
H2N5Y9_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
A0A2R9BPJ5_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2I3RTV4_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2I2YQH7_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K5C7L5_MCL1-01      -------------------------TSLEIISRYL---------------
A0A2K5I9I0_MCL1-02      -------------------EDELYRQSLEIISRYL---------------
A0A2K6GI15_MCL1-01      -------------------DDELYRQSLEIISRYL---------------
A0A2I3GJZ3_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K5CFH3_MCL1-03      -------------------EDELYRQSLEIISRYL---------------
A0A2K5R5E2_MCL1-03      -------------------EDELYRQSLEIISRYL---------------
A0A2K5W0W9_MCL1-01      -------------------EDELYRQSLEIISRYL---------------
A0A2K6ECR0_MCL1-02      -------------------EDELYRQSLEIISRYL---------------
A0A2I3LFM0_MCL1-01      -------------------EDELYRQSLEIISWYL---------------
A0A2K6KRW9_MCL1-02      -------------------EDELYRQSLEIISRYL---------------
A0A2K6PPI3_MCL1-02      -------------------EDELYRQSLEIISRYL---------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          -------------------EDELYGQSLELITRYL---------------
W5QI41_MCL1-01          -------------------EDELYRQSLEIISQYL---------------
F1MQX4_MCL1-01          -------------------EDELYWQSLEIISRYL---------------
A0A287BK44_MCL1-03      ---------------------MFGLQRNAVIGLNLYCGGAGLGPGSGSSA
B4DLY8_MCL1-01          -------------------DSR----------------------------
B4DG83_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
B4E3L8_MCL1-01          -------------------EDELYRQSLEIISRYL---------------
B6V6J0_MCL1-01          -------------------KDGLYMDTQQLILAFY---------------
G3PJT0_MCL1-01          ----------------------LESDTRQLLGRFL---------------
H0XHA5_MCL1-01          ----------------------LYWQSMEIISRYL---------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          -------------------L-----SLLEMIPQHL---------------
H9GEA6_MCL1-02          ----------------------LRKTTLEVVGRYL---------------
H9GEA6_MCL1-01          ----------------------LRKTTLEVVGRYL---------------
A0A493U0E8_MCL1-01      ---------------------RGRGGDLTILGWFH---------------
A0A1L1RNM6_MCL1-01      -------------------PDELRQESLELILRYL---------------
A0A1L1RNM6_MCL1-02      -------------------PDELRQESLELILRYL---------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          -------------------EDELYGQSLELISRYL---------------
F6ZMX1_MCL1-03          -------------------EDELYGQSLELISRYL---------------
F6ZMX1_MCL1-02          -------------------EDELYGQSLELISRYL---------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      -------------------EDALYRQSLEIISRYL---------------
B4DU51_MCL1-01          -------------------E--LYRQSLEIISRYL---------------
A0A287DCH9_MCL1-02      -------------------E--LYRQSLEIISRYL---------------
P97287_MCL1-01          -------------------D--LYRQSLEIISRYL---------------
A0A452GA25_MCL1-02      -------------------E--LYRQSLEIISQYL---------------
A0A287DCH9_MCL1-01      -------------------E--LYRQSLEIISRYL---------------
G3T756_MCL1-01          -------------------E--LYRQSLEIISRYL---------------
A0A1S3F3I1_MCL1-01      -------------------E--LYRQSLEIICRYL---------------
G1L3L7_MCL1-02          -------------------E--LYRQSLEIISRYL---------------
A0A287BK44_MCL1-01      -------------------E--LYRQSLEIISRYL---------------
A0A287BK44_MCL1-02      -------------------E--LYRQSLEIISRYL---------------
A0A3B1IEV7_MCL1-01      --------------SCRCPG-ALEAETRRLMVEFY---------------
A0A3B4CGU9_MCL1-03      -----------------GGS-ALVEETRRLIGGFY---------------
A0A3B4CGU9_MCL1-02      ISLCDGEVTVLIKPKPKGRV-RLEEETLCIIGDFY---------------
A0A3Q3VP02_MCL1-01      ------------SGCLAGDE-LLEKDTRQLISRVL---------------
A0A3B5K5B3_MCL1-01      ------------SGRPAEDEAALDNDTRQLLSCFM---------------
A0A3B3IJ04_MCL1-01      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
A0A3P9L1F3_MCL1-01      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
A0A3B3IJ04_MCL1-02      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
A0A3P9L1F3_MCL1-02      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
A0A3B3CEX1_MCL1-02      ------------LVPND--P-PINQDTTEFLTNFF---------------
A0A3B3CEX1_MCL1-01      ------------LVPND--P-PINQDTTEFLTNFF---------------
A0A3Q3B4P5_MCL1-01      ---------------GAEDE-VLENDTKHLISRFL---------------
A0A3Q3B4P5_MCL1-02      ---------------GAEDE-VLENDTKHLISRFL---------------
A0A3Q2EDX8_MCL1-01      ------------PGGHAGDE-ALDNDTKELISSFL---------------
A0A3Q2P7X9_MCL1-01      ------------CGSHAGQE-ALDSDTTELISGFL---------------
A0A3Q2P7X9_MCL1-02      ------------CGSHAGQE-ALDSDTTELISGFL---------------
A0A3B5PQ55_MCL1-02      ------------TAVGASNQ-VLDNDTTELISSFL---------------
A0A3B5PQ55_MCL1-01      ------------TAVGASNQ-VLDNDTTELISSFL---------------
A0A3P9Q4I8_MCL1-02      ------------SAVRASNQ-VLDNDTTELISSFL---------------
A0A3P9Q4I8_MCL1-01      ------------SAVRASNQ-VLDNDTTELISSFL---------------
A0A087X830_MCL1-01      ------------SAVRASNQ-VLDNDTMELISSFL---------------
A0A3B3YCD0_MCL1-01      ------------SAVRASNQ-VLDNDTMELISSFL---------------
I3JHR5_MCL1-01          ---------------GESDE-ELERETKLLIHSFL---------------
A0A3Q4HLQ8_MCL1-01      ---------------SESDE-QLERETKLLIHSFL---------------
A0A3P8NP63_MCL1-02      ---------------SESDE-QLERETKLLIHSFL---------------
A0A3Q2VNL8_MCL1-01      ---------------SESDE-QLERETKLLIHSFL---------------
A0A3P8NP63_MCL1-01      ---------------SESDE-QLERETKLLIHSFL---------------
A0A3P9BVM3_MCL1-01      ---------------SESDE-QLERETKLLIHSFL---------------
A0A3B4G4Z6_MCL1-01      ---------------SESDE-QLERETKLLIHSFL---------------
A0A2U9CJ81_MCL1-01      ------------SGCPAADE-ALDSFTRELISQFL---------------
A0A3P8VKM5_MCL1-05      ------------DVSQAGDE-VLDTDTKELIFQFY---------------
A0A3P8VKM5_MCL1-04      ------------DVSQAGDE-VLDTDTKELIFQFY---------------
A0A3P8VKM5_MCL1-03      ------------DVSQAGDE-VLDTDTKELIFQFY---------------
A0A3Q3IZW0_MCL1-01      ------------SSSPAEYE-VLENDTRLLICHFL---------------
A0A3Q1GX28_MCL1-02      ------------SSCPAGDE-VLENDTRQLLSQFL---------------
A0A3Q1GX28_MCL1-01      ------------SSCPAGDE-VLENDTRQLLSQFL---------------
A0A3B4XKA5_MCL1-01      ------------PSCPAG-E-VLESDTSQLISQSM---------------
A0A3Q3GP42_MCL1-01      ------------SSCPTGGE-VLESDTRQLISAFL---------------
A0A3Q3M6G2_MCL1-01      ------------PSCPAGDE-VLENDTRQLICQYL---------------
A0A3Q3M6G2_MCL1-02      ------------PSCPAGDE-VLENDTRQLICQYL---------------
A0A3B4AFB7_MCL1-01      ------------SSYSAEHE-VLESDTRQLLSDFF---------------
Q8UWD6_MCL1-01          ------------P------T-ALDMDTREIIDTFL---------------
A2BF68_MCL1-01          ------------P------T-ALDMDTREIIDTFL---------------
Q568W5_MCL1-01          ------------P------T-ALDMDTREIIDTFL---------------
A0A3B1K5R1_MCL1-01      ------------VGNCKQYE-TLDGDTREIISDFL---------------
A0A3B4C6H5_MCL1-01      ------------SDQFKESE-TLDRDTSEIVIDFL---------------
A0A3B4C6H5_MCL1-03      ------------SDQFKESE-TLDRDTSEIVIDFL---------------
Q568V1_MCL1-01          ---------------------ELERDTRQLLLDFY---------------
Q1L8X3_MCL1-01          ---------------------ELERDTRQLLLDFY---------------
Q9I9N3_MCL1-01          ---------------------ELERDTRQLLLDFY---------------
W5MMB7_MCL1-01          ------------EFLSEAHG-QLNAETRELIGTFL---------------
A0A3B3R4U0_MCL1-01      ------------TFPNRG----LSQETHELIGTFL---------------
A0A3B3SG34_MCL1-01      ------------CGFSRSAVEMLDQETSELITTFF---------------
A0A3Q2Y539_MCL1-01      ---------------PPGQG-VLDTETRRLIGRFL---------------
Q4SW32_MCL1-01          ------------SGRPAGDEAALDSDTRQLVSRLM---------------
D2ITA0_MCL1-03          --------------SQAGEE-VLDNDTKRIIRIFL---------------
D2ITA0_MCL1-04          --------------SQAGEE-VLDNDTKRIIRIFL---------------
A0A3P9ILF6_MCL1-01      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
A0A3P9ILF6_MCL1-02      ------------SGDNSGID-ALNEDTTEFLTNFF---------------
Q0KFR9_MCL1-01          ------------SNCPSGDE-VLEHDTRQLIENFL---------------
A0A3P8Y1W8_MCL1-02      ------------SHCPSGNE-VLDNDTRQLIENLL---------------
A0A3P8Y1W8_MCL1-01      ------------SHCPSGNE-VLDNDTRQLIENLL---------------
A0A3Q2XZL8_MCL1-01      ----------------GRND-VVDAETKGLIRRFL---------------
A0A3B4AFB7_MCL1-02      ------------SSYSAEHE-VLESDTRQLLSDFF---------------
A0A3B3VM25_MCL1-01      ------------SAVRASNQ-VLDNDTMELIGSFL---------------
A0A3Q0R633_MCL1-01      ------------------DE-ALERETKSLITSFF---------------
A0A3Q0R633_MCL1-03      ------------------DE-ALERETKSLITSFF---------------
A0A3B4T8L9_MCL1-02      ------------PSCPAGDE-VLEDDTRQLISQSM---------------
A0A3B4T8L9_MCL1-01      ------------PSCPAGDE-VLEDDTRQLISQSM---------------
A0A3Q1EQB9_MCL1-02      ------------SSCPTGDE-LLENDTRQLIRRFL---------------
A0A3B4ZKP6_MCL1-01      ------------SSCPAGDE-VLENDTRQLISSFL---------------
A0A3Q1BKL8_MCL1-02      ------------SSCPAGDE-LLENDTRQLLRRFL---------------
A0A3Q1EQB9_MCL1-01      ------------SSCPTGDE-LLENDTRQLIRRFL---------------
A0A3Q1BKL8_MCL1-01      ------------SSCPAGDE-LLENDTRQLLRRFL---------------
A0A3P8RQX7_MCL1-01      ------------SSCPAGDE-LLENDTRQLLRRFL---------------
A0A3P8RQX7_MCL1-02      ------------SSCPAGDE-LLENDTRQLLRRFL---------------
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------ATGAKDT-----------------------------------
A0A3P8V8T6_MCL1-01      -----KDFTTKSTQRLVES-------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          ------CEVAGCEST-----------------------------------
H3AR18_MCL1-01          ------CEVAGCEST-----------------------------------
J7H260_MCL1-01          -----REWAGDAKQ------------------------------------
G1PZ39_MCL1-01          -----REQATGAKDA-----------------------------------
Q9Z1P3_MCL1-01          -----REQATGSKDA-----------------------------------
A5PJR2_MCL1-01          -----REQATGAKDA-----------------------------------
A0A452GA25_MCL1-01      -----LEQATGAKDA-----------------------------------
G1L3L7_MCL1-01          -----REQATGAKDA-----------------------------------
G1T2Q0_MCL1-01          -----REQATGAKDA-----------------------------------
F7AVA6_MCL1-01          -----REQATGTKDT-----------------------------------
A0A337S3J9_MCL1-01      -----REQATGAKDA-----------------------------------
A0A337S3J9_MCL1-03      -----REQATGAKDA-----------------------------------
Q7YRZ9_MCL1-01          -----REQATGAKDA-----------------------------------
F1PAP1_MCL1-01          -----REQATGAKDA-----------------------------------
Q8HYS5_MCL1-01          -----REQATGAKDA-----------------------------------
M3XZZ5_MCL1-01          -----REQATGAKDA-----------------------------------
A0A452RHX5_MCL1-01      -----REQATGAKDA-----------------------------------
H0XFB7_MCL1-01          -----REQATGAKDA-----------------------------------
F7GTF7_MCL1-01          -----REQATGAKDT-----------------------------------
A0A2K5CFH3_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K6V5Y3_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K6KRW9_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K5XSB2_MCL1-01      -----REQATGAKDT-----------------------------------
A0A0D9RZP5_MCL1-01      -----REQATGAKDT-----------------------------------
I7G687_MCL1-01          -----REQATGAKDT-----------------------------------
A0A2K5LXU8_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2I3GJZ3_MCL1-02      -----REQATGAKDT-----------------------------------
H2N5Y9_MCL1-01          -----REQATGAKDT-----------------------------------
A0A2R9BPJ5_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2I3RTV4_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2I2YQH7_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K5C7L5_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K5I9I0_MCL1-02      -----REQATGAKDT-----------------------------------
A0A2K6GI15_MCL1-01      -----REQATGAKDA-----------------------------------
A0A2I3GJZ3_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K5CFH3_MCL1-03      -----REQATGAKDT-----------------------------------
A0A2K5R5E2_MCL1-03      -----REQATGAKDT-----------------------------------
A0A2K5W0W9_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K6ECR0_MCL1-02      -----REQATGAKDT-----------------------------------
A0A2I3LFM0_MCL1-01      -----REQATGAKDT-----------------------------------
A0A2K6KRW9_MCL1-02      -----REQATGAKDT-----------------------------------
A0A2K6PPI3_MCL1-02      -----REQATGAKDT-----------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          -----REQAVGTKDT-----------------------------------
W5QI41_MCL1-01          -----LEQATGTKDA-----------------------------------
F1MQX4_MCL1-01          -----REQATGAKDV-----------------------------------
A0A287BK44_MCL1-03      SAPGGRLLATGAKDA-----------------------------------
B4DLY8_MCL1-01          -----RVARPPPKDT-----------------------------------
B4DG83_MCL1-01          -----REQATGAKDT-----------------------------------
B4E3L8_MCL1-01          -----REQATGAKDT-----------------------------------
B6V6J0_MCL1-01          -----RVYSGEESGE-----------------------------------
G3PJT0_MCL1-01          -----REF------------------------------------------
H0XHA5_MCL1-01          -----WEQETG---------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          -----RE-RAGARDQ-----------------------------------
H9GEA6_MCL1-02          -----REAADEAGSKGTGPKFSFQ--------------------------
H9GEA6_MCL1-01          -----REAADEAGSKGTGPKFSFQ--------------------------
A0A493U0E8_MCL1-01      -----PTQKRAPEPAGRRDAAPPAAGCCTFKKCKRFRAGPHPFPHHPAGR
A0A1L1RNM6_MCL1-01      -----REAAGEAEPGVKK-----------------------LFPGLLGGP
A0A1L1RNM6_MCL1-02      -----REAAGEAEPGVKK-----------------------LFPGLLGGP
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          -----REQAVGTKEA-----------------------------------
F6ZMX1_MCL1-03          -----REQAVGTKEA-----------------------------------
F6ZMX1_MCL1-02          -----REQAVGTKEA-----------------------------------
G1T2Q0_MCL1-02          --------ATGAKDA-----------------------------------
F1PAP1_MCL1-02          --------ATGAKDA-----------------------------------
A0A337S3J9_MCL1-04      --------ATGAKDA-----------------------------------
F7AVA6_MCL1-02          --------ATGTKDT-----------------------------------
A0A2K6GI15_MCL1-03      --------ATGAKDA-----------------------------------
C8YZ26_MCL1-01          --------ATGAKDT-----------------------------------
F7GTF7_MCL1-02          --------ATGAKDT-----------------------------------
A0A2K5R5E2_MCL1-04      --------ATGAKDT-----------------------------------
A0A2K6V5Y3_MCL1-03      --------ATGAKDT-----------------------------------
A0A2K5LXU8_MCL1-03      --------ATGAKDT-----------------------------------
A0A2K5I9I0_MCL1-03      --------ATGAKDT-----------------------------------
A0A2I2YQH7_MCL1-03      --------ATGAKDT-----------------------------------
Q07820_MCL1-04          --------ATGAKDT-----------------------------------
A0A2K5W0W9_MCL1-03      --------ATGAKDT-----------------------------------
A0A2K6ECR0_MCL1-03      --------ATGAKDT-----------------------------------
A0A2K5XSB2_MCL1-03      --------ATGAKDT-----------------------------------
A0A2R9BPJ5_MCL1-03      --------ATGAKDT-----------------------------------
A0A2I3RTV4_MCL1-03      --------ATGAKDT-----------------------------------
A0A2I3LFM0_MCL1-03      --------ATGAKDT-----------------------------------
A0A2K6PPI3_MCL1-03      --------ATGAKDT-----------------------------------
A0A286Y1M5_MCL1-01      -----REQAAGAKDS-----------------------------------
B4DU51_MCL1-01          -----REQATGAKDT-----------------------------------
A0A287DCH9_MCL1-02      -----REQATGSKDA-----------------------------------
P97287_MCL1-01          -----REQATGSKDS-----------------------------------
A0A452GA25_MCL1-02      -----LEQATGAKDA-----------------------------------
A0A287DCH9_MCL1-01      -----REQATGSKDA-----------------------------------
G3T756_MCL1-01          -----QEQATGAKDT-----------------------------------
A0A1S3F3I1_MCL1-01      -----REQATGAKDA-----------------------------------
G1L3L7_MCL1-02          -----REQATGAKDA-----------------------------------
A0A287BK44_MCL1-01      -----REQATGAKDA-----------------------------------
A0A287BK44_MCL1-02      -----REQATGAKDA-----------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
                                                                          

I3KXG5_MCL1-01          -GDFTGLSQPQRKET--KALKMMKRVVA--DVLEKHRY---AYNGMINKL
A2BF68_MCL1-02          ------------------------------MILW-------TLSGMIARL
A0A2K5DMS4_MCL1-01      -KPMGRSEAANS-----KALETLRGVGE--GVPRNHEM---ALQGMLRNL
A0A3P8V8T6_MCL1-01      -----------------KALSTMKRVVK--GILDKHRH---AFSGMINNL
U3KKY6_MCL1-01          -----------------------------------------NLPGMLRKL
G1MPY7_MCL1-01          ------------------------------------------FSGMLRKL
K7FPN7_MCL1-01          --------------------------------------------GMLRKL
H3AR18_MCL1-02          -ETAFRFGLDQWSGGE-KPLDTLRRVGD--SIIDKHRI---AFNGMQQKL
H3AR18_MCL1-01          -ETAFRFGLDQWSGGE-KPLDTLRRVGD--SIIDKHRI---AFNGMQQKL
J7H260_MCL1-01          ------EDGDSP-----KALPTMRRLGG--DINEKHRM---AFQGMLQKL
G1PZ39_MCL1-01          -KPLGGPAASSR-----KALETLRRVGD--GVQRNHEM---AFQG-----
Q9Z1P3_MCL1-01          -KPLGEAGAAGR-----RALETLRRVGD--GVQRNHET---AFQGMLRKL
A5PJR2_MCL1-01          -KPLGGSGTTSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A452GA25_MCL1-01      -KPLGGSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
G1L3L7_MCL1-01          -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
G1T2Q0_MCL1-01          -KPMGRAGSASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F7AVA6_MCL1-01          -KPMGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A337S3J9_MCL1-01      -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A337S3J9_MCL1-03      -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
Q7YRZ9_MCL1-01          -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F1PAP1_MCL1-01          -KPLGGSRAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
Q8HYS5_MCL1-01          -KPLGGSRAASR-----KALETLQRVGD--GVQRNHET---AFQGMLRKL
M3XZZ5_MCL1-01          -KPLGGPGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A452RHX5_MCL1-01      -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
H0XFB7_MCL1-01          -KPMGRAGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F7GTF7_MCL1-01          -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5CFH3_MCL1-01      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6V5Y3_MCL1-01      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6KRW9_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5XSB2_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A0D9RZP5_MCL1-01      -KPMSRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
I7G687_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5LXU8_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I3GJZ3_MCL1-02      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
H2N5Y9_MCL1-01          -KPLGRSGATCR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2R9BPJ5_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I3RTV4_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I2YQH7_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5C7L5_MCL1-01      -KPMDRSGAASR-----KALETLRRVGD--GVQRNHET---AFQ-----V
A0A2K5I9I0_MCL1-02      -QPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K6GI15_MCL1-01      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2I3GJZ3_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K5CFH3_MCL1-03      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K5R5E2_MCL1-03      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K5W0W9_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K6ECR0_MCL1-02      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2I3LFM0_MCL1-01      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K6KRW9_MCL1-02      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
A0A2K6PPI3_MCL1-02      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGWVCGV
Q95KR3_MCL1-01          ------MFGLQR-----NAVIGLNLYCG--GAGLGPGSGSSAFQGMLRKL
A0A2K5EPX0_MCL1-02      ------SQSYNN-----LKIT--------------------TC--MLRKL
A0A2K5EPX0_MCL1-01      ------NASCSR-----PACF--------------------SSPGMLRKL
G3WBC5_MCL1-01          -KPL-----RSG-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
W5QI41_MCL1-01          -KPLGGSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F1MQX4_MCL1-01          -KPLGGSGATSR-----KALETLHRVGD--GVQHNHET---AFQGMLQKL
A0A287BK44_MCL1-03      -KPMGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
B4DLY8_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
B4DG83_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
B4E3L8_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
B6V6J0_MCL1-01          ----LEASCLLQHGVHHKALETLLRVGG--EIIEKHHM---AFTGMLQRL
G3PJT0_MCL1-01          -TGLSKTQWNPS-----RELTTMKRVVG--DVLEKHRY---VFNGMVNKL
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      ------------------------------GWAWLGLK---AFQGMLQKL
G1QAV8_MCL1-01          -SQGPRVGGVQR------------RAAGCSGVRQ--ET---AFLGML-EL
H9GEA6_MCL1-02          -GLLGRFGSSPNEAEVARALETLRRVGE--SLREKHLL---AFQGMLRKL
H9GEA6_MCL1-01          -GLLGRFGSSPNEAEVARALETLRRVGE--SLREKHLL---AFQGMLRKL
A0A493U0E8_MCL1-01      DFWGFTTPGQIF-----GVLARKPHSGEQGGVTVEDLG---RSLGMLRKL
A0A1L1RNM6_MCL1-01      GRPGRASSAVME-----KALETLRRVGD--GVMQKHEL---AFQGMLRKL
A0A1L1RNM6_MCL1-02      GRPGRASSAVME-----KALETLRRVGD--GVMQKHEL---AFQGMLRKL
G2HFR3_MCL1-01          -----------------------------------------------MLL
F6ZMX1_MCL1-01          -KPL-----RSG-----KALETLRRVGD--GVQRNHER---AFQGMLRKL
F6ZMX1_MCL1-03          -KPL-----RSG-----KALETLRRVGD--GVQRNHER---AFQGMLRKL
F6ZMX1_MCL1-02          -KPL-----RSG-----KALETLRRVGD--GVQRNHER---AFQGMLRKL
G1T2Q0_MCL1-02          -KPMGRAGSASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F1PAP1_MCL1-02          -KPLGGSRAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A337S3J9_MCL1-04      -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
F7AVA6_MCL1-02          -KPMGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6GI15_MCL1-03      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
C8YZ26_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRRL
F7GTF7_MCL1-02          -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5R5E2_MCL1-04      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6V5Y3_MCL1-03      -KPMGRSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5LXU8_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5I9I0_MCL1-03      -QPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I2YQH7_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
Q07820_MCL1-04          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5W0W9_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6ECR0_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K5XSB2_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2R9BPJ5_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I3RTV4_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2I3LFM0_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A2K6PPI3_MCL1-03      -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A286Y1M5_MCL1-01      -KPLGGVGPTSR-----KALETLRRVGD--GVQRNHQT---AFQGMLRKL
B4DU51_MCL1-01          -KPMGRSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A287DCH9_MCL1-02      -KPLRGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
P97287_MCL1-01          -KPLGEAGAAGR-----RALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A452GA25_MCL1-02      -KPLGGSGATSR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A287DCH9_MCL1-01      -KPLRGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
G3T756_MCL1-01          -KPMGGSGAASR-----KALETLRRVAD--GVQRNHET---AFQGMLRKL
A0A1S3F3I1_MCL1-01      -KPLGGAGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
G1L3L7_MCL1-02          -KPLGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A287BK44_MCL1-01      -KPMGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A287BK44_MCL1-02      -KPMGGSGAASR-----KALETLRRVGD--GVQRNHET---AFQGMLRKL
A0A3B1IEV7_MCL1-01      -RGYLG--QK-PREQS-PALRTMSRVVA--GVVLKHGI---AYNGMVQKL
A0A3B4CGU9_MCL1-03      -RGYIG--QK-TRDQH-PAHGTMSRVVE--GVILKHSI---AYNGMVQRL
A0A3B4CGU9_MCL1-02      -QGY-----R-SRNQH-PASDTLSRVVE--GMLHKHSV---AYSGMVQRL
A0A3Q3VP02_MCL1-01      -MELSGHGRA-RWTES-RTLSTMKRVVA--ELLEKHRY---VYNGMTKRL
A0A3B5K5B3_MCL1-01      -ADFCGIGSH-QWRES-GALSTMKRVVA--NLMEKHRY---VYNGMTKQL
A0A3B3IJ04_MCL1-01      -RNFVGISQY-RHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
A0A3P9L1F3_MCL1-01      -RNFVGISQY-RHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
A0A3B3IJ04_MCL1-02      -RNFVGISQY-RHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
A0A3P9L1F3_MCL1-02      -RNFVGISQY-RHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
A0A3B3CEX1_MCL1-02      -RNYVGLSQS-RHRES-KYISTAKRVVN--DMMDKHRF---AFNGMINRL
A0A3B3CEX1_MCL1-01      -RNYVGLSQS-RHRES-KYISTAKRVVN--DMMDKHRF---AFNGMINRL
A0A3Q3B4P5_MCL1-01      -QEFTGLSKR-QWSES-KELSTMNRVVE--DLLTKHRF---AYNGIIKKL
A0A3Q3B4P5_MCL1-02      -QEFTGLSKR-QWSES-KELSTMNRVVE--DLLTKHRF---AYNGIIKKL
A0A3Q2EDX8_MCL1-01      -RDFTGLPKQ-RRNQT-KALSTMKRVVE--DVLSKHRY---AYNGMMNKL
A0A3Q2P7X9_MCL1-01      -RDFTGLSGH-RWYTK-KSLSTMKRVVE--DLLSKHRY---AYTGMIRKL
A0A3Q2P7X9_MCL1-02      -RDFTGLSGH-RWYTK-KSLSTMKRVVE--DLLSKHRY---AYTGMIRKL
A0A3B5PQ55_MCL1-02      -RDFTGLSKC-RWGQN-KALSTMKRVVE--DLLSKHKY---AYNGMVNRL
A0A3B5PQ55_MCL1-01      -RDFTGLSKC-RWGQN-KALSTMKRVVE--DLLSKHKY---AYNGMVNRL
A0A3P9Q4I8_MCL1-02      -RNFTGLSKC-RWSQN-KALSTMKRVVE--DVLSKHRY---AYNGMLSKL
A0A3P9Q4I8_MCL1-01      -RNFTGLSKC-RWSQN-KALSTMKRVVE--DVLSKHRY---AYNGMLSKL
A0A087X830_MCL1-01      -RNFTGLSKC-RWSQN-KALSTMKRVVE--DVLSKHRY---AYNGMLNRL
A0A3B3YCD0_MCL1-01      -RHFTGLSKC-RWSQN-KALSTMKRVVE--DVLSKHRY---AYNGMLNRL
I3JHR5_MCL1-01          -GDFTGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3Q4HLQ8_MCL1-01      -GDFTGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3P8NP63_MCL1-02      -GDFIGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3Q2VNL8_MCL1-01      -GDFTGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3P8NP63_MCL1-01      -GDFIGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3P9BVM3_MCL1-01      -GDFIGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A3B4G4Z6_MCL1-01      -GDFTGLSQP-QRKET-KALKTMKRVVA--DVLEKHRY---AYNGMINKL
A0A2U9CJ81_MCL1-01      -RDYVARTDP-RWTDS-KALSTMKRVVD--RLVEKHRY---AYNGMMNRL
A0A3P8VKM5_MCL1-05      -RDFTTHSPS-KWGER-KALTTMKRVVD--DVLEKHRY---AYNGMINKL
A0A3P8VKM5_MCL1-04      -RDFTTHSPS-KWGER-KALTTMKRVVD--DVLEKHRY---AYNGMINKL
A0A3P8VKM5_MCL1-03      -RDFTTHSPS-KWGER-KALTTMKRVVD--DVLEKHRY---AYNGMINKL
A0A3Q3IZW0_MCL1-01      -RDYTGLSTH-RWTRR-KTLSTMKRVVE--GVLEKHRY---AYKGMINKL
A0A3Q1GX28_MCL1-02      -QDFSGLTKP-RWCET-KELSTMKRVVN--DVLEKHRY---AYNGMINKL
A0A3Q1GX28_MCL1-01      -QDFSGLTKP-RWCET-KELSTMKRVVN--DVLEKHRY---AYNGMINKL
A0A3B4XKA5_MCL1-01      -KSFTGRSIQ-RRTEH-RALQTMKRVVE--GVLEKHRY---AYNGMINKL
A0A3Q3GP42_MCL1-01      -REHTGLSKP-GWNES-SALSTMKRVVE--DVLAKHRY---AYNGMINKL
A0A3Q3M6G2_MCL1-01      -KDVSGLSKP-RWHDS-KALSTMKRVVE--DLLEKYRY---TYNGMINKL
A0A3Q3M6G2_MCL1-02      -KDVSGLSKP-RWHDS-KALSTMKRVVE--DLLEKYRY---TYNGMINKL
A0A3B4AFB7_MCL1-01      -KLFTGISQP-KWKQR-PALSTMKGVVD--KLLEKHRY---AYNGMINKL
Q8UWD6_MCL1-01          -KIFTGLPHS-KSGRK-QVLSTMRRVVD--NLAVKHEL---AYKGMIARL
A2BF68_MCL1-01          -KIFTGLPHS-KSGRK-QVLSTMRRVVD--NLAVKHEL---AYKGMIARL
Q568W5_MCL1-01          -IIFTGLPHS-KSGRK-QVLSTMRRVVD--NLAVKHEL---AYKGMIARL
A0A3B1K5R1_MCL1-01      -RNFCGLSRS-CGGHG-AVVQTMKRVVD--DLVVKHGI---AYKGMLNKL
A0A3B4C6H5_MCL1-01      -QNFTGLSRS-CGRHR-GVVQTIRRVVD--GLVVKHEL---VYKGMFTRL
A0A3B4C6H5_MCL1-03      -QNFTGLSRS-CGRHR-GVVQTIRRVVD--GLVVKHEL---VYKGMFTRL
Q568V1_MCL1-01          -RTHTGMCPV-DRKLH-HAIPTMKRVVD--NILVKHQI---AYKGMIQRL
Q1L8X3_MCL1-01          -RTHTGMCPV-DRKLH-HAIPTMKRVVD--NILVKHQI---AYKGMIQRL
Q9I9N3_MCL1-01          -RTHTGMCPV-DRKLH-HAIPTMKRVVD--NILVKHQI---AYKGMIQRL
W5MMB7_MCL1-01          -QMYTGLPH--RRSRG-KALETLKRVVD--SVVAKHQI---AYHGMIAKL
A0A3B3R4U0_MCL1-01      -RTYSGLPAS--ASRH-KAYPVLRRVAE--TVIGKHLI---AYNGMIKKL
A0A3B3SG34_MCL1-01      -AEYTGLCAT-LQRRN-EALSTLKRVVA--TVVEKHKF---AYNGMIGKL
A0A3Q2Y539_MCL1-01      -RDFTGLSTA-AWIQS-KAQSTMKRVVT--RLVDKHRI---LFNNMVNEL
Q4SW32_MCL1-01          -ADVTGISRA-QWRES-RALATTKRVVG--DLMEKHRY---TYRGMINKL
D2ITA0_MCL1-03          -RDYAGASKAKRTRQD-EVQVTMRRVVD--GVLEKHQY---AYKGMIQKL
D2ITA0_MCL1-04          -RDYAGASKAKRTRQD-EVQVTMRRVVD--GVLEKHQY---AYKGMIQKL
A0A3P9ILF6_MCL1-01      -RNFVGISQY-PHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
A0A3P9ILF6_MCL1-02      -RNFVGISQY-PHRDN-KYMSTAKRVVN--DVLEKHKI---TYNGMIVRL
Q0KFR9_MCL1-01          -GDYTGLSQP-RWTQS-KPLTTMKRVVE--DVIAKHRY---AYNGMVAKL
A0A3P8Y1W8_MCL1-02      -RDYTGLSQP-RWKQN-KSLVTMKRVVG--DVIAKHTY---AYKGMISKL
A0A3P8Y1W8_MCL1-01      -RDYTGLSQP-RWKQN-KSLVTMKRVVG--DVIAKHTY---AYKGMISKL
A0A3Q2XZL8_MCL1-01      -TDFTGLSTA-SWNES-KAHSTMKRVVA--KVLEKHKY---KYNGIINKL
A0A3B4AFB7_MCL1-02      -KLFTGISQP-KWKQR-PALSTMKGVVD--KLLEKHRY---AYNGMINKL
A0A3B3VM25_MCL1-01      -RNFTGLSKC-RWSQN-KALSTMKRVVE--DVLSKHRY---AYNGMLNRL
A0A3Q0R633_MCL1-01      -RDFTGLSQR-RWKES-EALKTMKRVVA--DVLEKHRY---AYNGMVNKL
A0A3Q0R633_MCL1-03      -RDFTGLSQR-RWKES-EALKTMKRVVA--DVLEKHRY---AYNGMVNKL
A0A3B4T8L9_MCL1-02      -KSFTGRSIP-RWTEH-RALQTMKRVVD--GVLEKHRY---AYNGMINKL
A0A3B4T8L9_MCL1-01      -KSFTGRSIP-RWTEH-RALQTMKRVVD--GVLEKHRY---AYNGMINKL
A0A3Q1EQB9_MCL1-02      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---SYNGMINKL
A0A3B4ZKP6_MCL1-01      -KDFTGLSKP-RWNEG-KALSTMKRVVE--DVLEKHRY---AYNGMINKL
A0A3Q1BKL8_MCL1-02      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---AYNGMINKL
A0A3Q1EQB9_MCL1-01      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---SYNGMINKL
A0A3Q1BKL8_MCL1-01      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---AYNGMINKL
A0A3P8RQX7_MCL1-01      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---AYNGMINKL
A0A3P8RQX7_MCL1-02      -RDFTGLSKP-RWNES-KALSTMKRVVD--DVLDKHRY---AYNGMINKL
                                                                          

I3KXG5_MCL1-01          SLDEREEDMSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEKGRD
A2BF68_MCL1-02          NLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHS
A0A2K5DMS4_MCL1-01      DNKNE-DNVKSFY---------GVTNWGRIVTLSSFGAFVAKHLKTINQE
A0A3P8V8T6_MCL1-01      SFENGVYNIGVVGAVARSLFRDGTSNWGRIVSLVAFGAVLCQHLKEKGWE
U3KKY6_MCL1-01          EIQQE-EDLQSVVEVAAHVFSDGVTNWGRVVTLIAFGAFVAKHLKSIKQE
G1MPY7_MCL1-01          EIKKE-EDLQAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQE
K7FPN7_MCL1-01          DIKNE-EDLKSVSSVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQE
H3AR18_MCL1-02          NIHKE-DDLHIIPEIGNQIFKDGATNWGRIVSLIAFGAVVAKKLKKMNLE
H3AR18_MCL1-01          NIHKE-DDLHIIPEIGNQIFKDGATNWGRIVSLIAFGAVVAKKLKKMNLE
J7H260_MCL1-01          SIQRP-EDIQKLSEVPSMVFSDGVTNWGRIVTVISFGAFVAKHLKSIHME
G1PZ39_MCL1-01          ----E-RGPRALCLVRDRWAPVGGNRDEPGLEGLS-ARFRNQHILAMSH-
Q9Z1P3_MCL1-01          DIKNE-DDVKSFSRVMTHVFKDGVTNWGRIVTLISFGAFVAKHLKSINQE
A5PJR2_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A452GA25_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
G1L3L7_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
G1T2Q0_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F7AVA6_MCL1-01          DIKNE-DDVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A337S3J9_MCL1-01      DIKNE-NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A337S3J9_MCL1-03      DIKNE-NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
Q7YRZ9_MCL1-01          DIKNE-NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F1PAP1_MCL1-01          DIKNE-DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
Q8HYS5_MCL1-01          DIKNE-DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
M3XZZ5_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A452RHX5_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
H0XFB7_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F7GTF7_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5CFH3_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K6V5Y3_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K6KRW9_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5XSB2_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A0D9RZP5_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
I7G687_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5LXU8_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I3GJZ3_MCL1-02      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
H2N5Y9_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2R9BPJ5_MCL1-01      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I3RTV4_MCL1-01      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I2YQH7_MCL1-01      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5C7L5_MCL1-01      ------------------LPCRRPRRW---------------------HQ
A0A2K5I9I0_MCL1-02      ------------------LPCRGPRRW---------------------HQ
A0A2K6GI15_MCL1-01      ------------------LPCRGPRRR---------------------HQ
A0A2I3GJZ3_MCL1-01      ------------------LPCRGPRRW---------------------HQ
A0A2K5CFH3_MCL1-03      ------------------LPCRGPRRW---------------------HQ
A0A2K5R5E2_MCL1-03      ------------------LPCRGPRRW---------------------HQ
A0A2K5W0W9_MCL1-01      ------------------LPCRGPRRW---------------------HQ
A0A2K6ECR0_MCL1-02      ------------------LPCRGPRRW---------------------HQ
A0A2I3LFM0_MCL1-01      ------------------LPCRGPRRW---------------------HQ
A0A2K6KRW9_MCL1-02      ------------------LPCRGPRRW---------------------HQ
A0A2K6PPI3_MCL1-02      ------------------LPCRGPRRW---------------------HQ
Q95KR3_MCL1-01          DIKNE-DDVKSLSRVMVHVLSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A2K5EPX0_MCL1-02      DIKNK-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5EPX0_MCL1-01      DIKNK-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
G3WBC5_MCL1-01          DIKNE-EDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
W5QI41_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F1MQX4_MCL1-01          DIKNE-DDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQE
A0A287BK44_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
B4DLY8_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
B4DG83_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
B4E3L8_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDSVTNWGRIVTLISFGAFVAKHLKTINQE
B6V6J0_MCL1-01          SIHSR-EDLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSLNLE
G3PJT0_MCL1-01          SLDDRGDDASFVREVATSLFADGTTNWGRIASLVAFGAVVCQHLAERGRG
H0XHA5_MCL1-01          ------EDINSLSRVMAHVFSYGVTNWGRIMTLI-FGGFVAKHLKTINQE
A0A2K6F6N9_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHLKTINQE
G1QAV8_MCL1-01          DTENE-DNVKSSSQAMVHAFRDGVTN-GRIVTHFFWC--LCSHLKSINQE
H9GEA6_MCL1-02          EIKKE-EDLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQE
H9GEA6_MCL1-01          EIKKE-EDLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQE
A0A493U0E8_MCL1-01      EIKKE-EDLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQE
A0A1L1RNM6_MCL1-01      EIKKE-DDLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQE
A0A1L1RNM6_MCL1-02      EIKKE-DDLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQE
G2HFR3_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
F6ZMX1_MCL1-01          DIKNE-EDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQE
F6ZMX1_MCL1-03          DIKNE-EDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQE
F6ZMX1_MCL1-02          DIKNE-EDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQE
G1T2Q0_MCL1-02          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F1PAP1_MCL1-02          DIKNE-DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A337S3J9_MCL1-04      DIKNE-NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
F7AVA6_MCL1-02          DIKNE-DDVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A2K6GI15_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
C8YZ26_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
F7GTF7_MCL1-02          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5R5E2_MCL1-04      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLIYFGAFVAKHLKTINQE
A0A2K6V5Y3_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5LXU8_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5I9I0_MCL1-03      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I2YQH7_MCL1-03      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
Q07820_MCL1-04          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5W0W9_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K6ECR0_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K5XSB2_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2R9BPJ5_MCL1-03      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I3RTV4_MCL1-03      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2I3LFM0_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A2K6PPI3_MCL1-03      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A286Y1M5_MCL1-01      DIKNE-DDVKSLSRVVALVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
B4DU51_MCL1-01          DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQE
A0A287DCH9_MCL1-02      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
P97287_MCL1-01          DIKNE-GDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQE
A0A452GA25_MCL1-02      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A287DCH9_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
G3T756_MCL1-01          DIKNE-DDVKSLSRVMAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQE
A0A1S3F3I1_MCL1-01      DIKNE-DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
G1L3L7_MCL1-02          DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A287BK44_MCL1-01      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A287BK44_MCL1-02      DIKNE-DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQE
A0A3B1IEV7_MCL1-01      NLEEQDDSMDIISSVAKALFSDGTTNWGRIVSLVAFGAVVCDHLKKKSRD
A0A3B4CGU9_MCL1-03      CLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLVAFGAVVCEQMKEAGRE
A0A3B4CGU9_MCL1-02      CLEQQDDSMEFISSVAKTLFDDGITNWGRIASLVALGAVVCEWLKEVGRE
A0A3Q3VP02_MCL1-01      SLADTQDNVSFVSTVSRDLFSDGATNWGRIASLVAFGVVVSQCLKENGKS
A0A3B5K5B3_MCL1-01      TLDDRGDDVSFVSSVAKSIFADGVTNWGRIASLVAFGAVVAQHMKDNGRR
A0A3B3IJ04_MCL1-01      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
A0A3P9L1F3_MCL1-01      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
A0A3B3IJ04_MCL1-02      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
A0A3P9L1F3_MCL1-02      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
A0A3B3CEX1_MCL1-02      SLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRG
A0A3B3CEX1_MCL1-01      SLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRG
A0A3Q3B4P5_MCL1-01      SLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGRE
A0A3Q3B4P5_MCL1-02      SLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGRE
A0A3Q2EDX8_MCL1-01      CLDEVPDNMGFVSSVATSLFSDGTTNWGRIVSLVAFGAVVCQHLKEKGRE
A0A3Q2P7X9_MCL1-01      NLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRS
A0A3Q2P7X9_MCL1-02      NLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRS
A0A3B5PQ55_MCL1-02      ALDNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGRE
A0A3B5PQ55_MCL1-01      ALDNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGRE
A0A3P9Q4I8_MCL1-02      ALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGRE
A0A3P9Q4I8_MCL1-01      ALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGRE
A0A087X830_MCL1-01      ALDNQPDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGAAVCQHLKERGRE
A0A3B3YCD0_MCL1-01      ALDNQPDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGAAVCQHLKERGRE
I3JHR5_MCL1-01          SLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRD
A0A3Q4HLQ8_MCL1-01      SLDERDEDMSFVGAVAKSLFGDHTTNWGRVVSFVAFGAVVSQHLKEKGRD
A0A3P8NP63_MCL1-02      SLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRD
A0A3Q2VNL8_MCL1-01      SLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRD
A0A3P8NP63_MCL1-01      SLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRD
A0A3P9BVM3_MCL1-01      SLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRD
A0A3B4G4Z6_MCL1-01      SLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRD
A0A2U9CJ81_MCL1-01      SLDNRRDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGAVVSQHLKETGRG
A0A3P8VKM5_MCL1-05      SLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQE
A0A3P8VKM5_MCL1-04      SLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQE
A0A3P8VKM5_MCL1-03      SLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQE
A0A3Q3IZW0_MCL1-01      SLDERGDDMSFVGSVAQSIFADGTTNWGRITSLLAFGAVVCQYLKEKGRE
A0A3Q1GX28_MCL1-02      SLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGAAVCQHLKEKHRE
A0A3Q1GX28_MCL1-01      SLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGAAVCQHLKEKHRE
A0A3B4XKA5_MCL1-01      SLDNRGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGVVVCQHMKDTGRE
A0A3Q3GP42_MCL1-01      SLEDRGDDASFVSAVAKSLFADGTTNWGRIASLVAFGAAVSQYLKENGRG
A0A3Q3M6G2_MCL1-01      SLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRG
A0A3Q3M6G2_MCL1-02      SLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRG
A0A3B4AFB7_MCL1-01      ALDDRGDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGAVVCQYLKTKGRE
Q8UWD6_MCL1-01          NLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHS
A2BF68_MCL1-01          NLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHS
Q568W5_MCL1-01          NLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHS
A0A3B1K5R1_MCL1-01      GMEDRGDDMYVIRAVAKELFSDGITNWGRVASLVAFGAVVSKHQHDMGRG
A0A3B4C6H5_MCL1-01      GMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGAVVCQHQNQMGRG
A0A3B4C6H5_MCL1-03      GMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGAVVCQHQNQMGRG
Q568V1_MCL1-01          QLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQD
Q1L8X3_MCL1-01          QLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQD
Q9I9N3_MCL1-01          QLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQD
W5MMB7_MCL1-01          ELENKGEDVSFVTGVAKSLFSDGKTNWGRIASLVSFGAVVAKQMKDSGRE
A0A3B3R4U0_MCL1-01      ELDKRGDDTSFVTKVAEEIFSDKVTNWGRIASLIAFGGVVCKYLKDHGQT
A0A3B3SG34_MCL1-01      SLNQQSDDMTVIKTVAERIFSDGTTNWGRIASLVAFGAEVCKYLKETGRE
A0A3Q2Y539_MCL1-01      SLDQRGLDRSFVSQVAQTEFANGNINWGRIASLLAFCAVLSQALKENQQE
Q4SW32_MCL1-01          FMEDRVGDVSFVGAVAKSTFEDGNTNWGRVASLLAFAAVVAQYLNDHGQR
D2ITA0_MCL1-03          ELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKE
D2ITA0_MCL1-04          ELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKE
A0A3P9ILF6_MCL1-01      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
A0A3P9ILF6_MCL1-02      SLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRG
Q0KFR9_MCL1-01          DLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRG
A0A3P8Y1W8_MCL1-02      CLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKG
A0A3P8Y1W8_MCL1-01      CLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKG
A0A3Q2XZL8_MCL1-01      SLDDRGDNVSFISEVAKSLFSDGTTNWGRVASLVAFGAIVSQHLKEKGRA
A0A3B4AFB7_MCL1-02      ALDDRGDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGAVVCQYLKTKGRE
A0A3B3VM25_MCL1-01      ALDNQPDNMGFVTEVAQNLFSDGTTNWGRIVSLVAFGAAVCQHLKERGRE
A0A3Q0R633_MCL1-01      SLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRD
A0A3Q0R633_MCL1-03      SLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRD
A0A3B4T8L9_MCL1-02      SLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRE
A0A3B4T8L9_MCL1-01      SLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRE
A0A3Q1EQB9_MCL1-02      SLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3B4ZKP6_MCL1-01      SLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3Q1BKL8_MCL1-02      SLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3Q1EQB9_MCL1-01      SLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3Q1BKL8_MCL1-01      SLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3P8RQX7_MCL1-01      SLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
A0A3P8RQX7_MCL1-02      SLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRE
                                                 .                        

I3KXG5_MCL1-01          NCVVLVSQEISAYLLSEQRDWIIKNNAW---DGFVAFVRVADPESI----
A2BF68_MCL1-02          KYVRLVGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA----
A0A2K5DMS4_MCL1-01      SCIEPLAESI-------------RYSRW---DGFVEFFRVEDLEGG----
A0A3P8V8T6_MCL1-01      NTVDQVGQEIASYLLSYQKDWLLKNNSW---DGFVEFFQGQEPEKA----
U3KKY6_MCL1-01          QSITSLAGIITDALVSSKRQWLESQGGW----------------------
G1MPY7_MCL1-01          KCISSLAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS----
K7FPN7_MCL1-01          NCINTLAGIITDVLVSDKRDWLVNQRGW---EGFVEFFRVEDLEGS----
H3AR18_MCL1-02          DSIEQLAVSITDFLVQNKGDWILKNQGW---KGFVDFFHVEDAEGT----
H3AR18_MCL1-01          DSIEQLAVSITDFLVQNKGDWILKNQGW---KGFVDFFHVEDAEGT----
J7H260_MCL1-01          NCVGILADSFTDYLMTQKKEWIVEHNGW---DGCVEFFHVEDYESG----
G1PZ39_MCL1-01          -CFRPPDSLGTALRSKAGKVWETSNTCHGFKDGFVEFFHVEDLEGG----
Q9Z1P3_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVQDLEGG----
A5PJR2_MCL1-01          SCIEPLAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG----
A0A452GA25_MCL1-01      SCIEPLAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG----
G1L3L7_MCL1-01          GCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
G1T2Q0_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLESG----
F7AVA6_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A337S3J9_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A337S3J9_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
Q7YRZ9_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
F1PAP1_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
Q8HYS5_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
M3XZZ5_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A452RHX5_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
H0XFB7_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
F7GTF7_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5CFH3_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6V5Y3_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6KRW9_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5XSB2_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A0D9RZP5_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
I7G687_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5LXU8_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I3GJZ3_MCL1-02      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
H2N5Y9_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2R9BPJ5_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I3RTV4_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I2YQH7_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5C7L5_MCL1-01      KCAAGFCRCCWS------RSWF----------------------------
A0A2K5I9I0_MCL1-02      KCAAGFCRCCWS------RSWF----------------------------
A0A2K6GI15_MCL1-01      KCAAGFCRCCWS------RSWF----------------------------
A0A2I3GJZ3_MCL1-01      KCAAGFCRCCWS------RSWF----------------------------
A0A2K5CFH3_MCL1-03      KCAAGFCRCCWS------RSWF----------------------------
A0A2K5R5E2_MCL1-03      KCAAGFCRCCWS------RSWF----------------------------
A0A2K5W0W9_MCL1-01      KCAAGFCRCCWS------RSWF----------------------------
A0A2K6ECR0_MCL1-02      KCAAGFCRCCWS------RSWF----------------------------
A0A2I3LFM0_MCL1-01      KCAAGFCRCCWS------RSWF----------------------------
A0A2K6KRW9_MCL1-02      KCAAGFCRCCWS------RSWF----------------------------
A0A2K6PPI3_MCL1-02      KCAAGFCRCCWS------RSWF----------------------------
Q95KR3_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5EPX0_MCL1-02      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5EPX0_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
G3WBC5_MCL1-01          SCIDPLAESITDVLVKSKRDWLMKQKGW---EGFVEFFHVEDLEGG----
W5QI41_MCL1-01          SCIEPLAESITDVLVRSKRDWIVKQRGW---DGFVEFFRVEDLEGG----
F1MQX4_MCL1-01          SCIEPLAESITDVLVRSKRDWIVKERGW---DGFVEFFHVEDLEGG----
A0A287BK44_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
B4DLY8_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
B4DG83_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
B4E3L8_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
B6V6J0_MCL1-01          DCIGVLAEHFTQFLMMSKKDWIIQEKGW---DGFVDFFHIEDYESG----
G3PJT0_MCL1-01          NCVELVGQEISAYLLSDQRDWLIKNNAW---VGFVEFFRVADPESA----
H0XHA5_MCL1-01          GYIKPLEENIADVLVRTKPDWLVKQRGW---DGFVEFFYLEDLESS----
A0A2K6F6N9_MCL1-01      SCIEPLAESITDILVRTKRDWL--------------FFHVEDLEGS----
G1QAV8_MCL1-01          SCIEPLAEDITDVLVGTERGWLVKQRGW---DGFVEFFQVEDLEGG----
H9GEA6_MCL1-02          NAINTLIEIITDVLVTDKREWLLKHNAW---EGFVQFFHVEDIEGG----
H9GEA6_MCL1-01          NAINTLIEIITDVLVTDKREWLLKHNAW---HNCV---------------
A0A493U0E8_MCL1-01      KSIGSLARIITDALVSSKREWLVSQGGW---EGFVDFFRVEDLEGS----
A0A1L1RNM6_MCL1-01      KCITSLAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS----
A0A1L1RNM6_MCL1-02      KCITSLAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS----
G2HFR3_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
F6ZMX1_MCL1-01          SCIDPLAESITDVLVKTKRDWLIKQKGW---KGLLAQDTEEATRTGDPCA
F6ZMX1_MCL1-03          SCIDPLAESITDVLVKTKRDWLIKQKGW---EGFVEFFHVQDLEGG----
F6ZMX1_MCL1-02          SCIDPLAESITDVLVKTKRDWLIKQKGW---SGKERVDPRGLVSGG----
G1T2Q0_MCL1-02          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLESG----
F1PAP1_MCL1-02          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A337S3J9_MCL1-04      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
F7AVA6_MCL1-02          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6GI15_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
C8YZ26_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFQVEDLEGG----
F7GTF7_MCL1-02          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5R5E2_MCL1-04      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6V5Y3_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5LXU8_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5I9I0_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I2YQH7_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
Q07820_MCL1-04          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5W0W9_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6ECR0_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K5XSB2_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2R9BPJ5_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I3RTV4_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2I3LFM0_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A2K6PPI3_MCL1-03      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A286Y1M5_MCL1-01      SCIEPLAESITDALVHSKRDWLVKQRGW---DGFVEFFHIEDLEGG----
B4DU51_MCL1-01          SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A287DCH9_MCL1-02      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
P97287_MCL1-01          SFIEPLAETITDVLVRTKRDWLVKQRGW---DGFVEFFHVQDLEGG----
A0A452GA25_MCL1-02      SCIEPLAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG----
A0A287DCH9_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
G3T756_MCL1-01          SRIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A1S3F3I1_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGS----
G1L3L7_MCL1-02          GCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A287BK44_MCL1-01      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A287BK44_MCL1-02      SCIEPLAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG----
A0A3B1IEV7_MCL1-01      HCVENVAQHISTYLNTHQHQWLINNNAW---DGFVEFFREDDSESR----
A0A3B4CGU9_MCL1-03      QCVENVIQHISTYLSTDQRQWLINNKAW---GGFVEFFREDDSESR----
A0A3B4CGU9_MCL1-02      QCVENVIQHISMYLSTDQRQWLINNKAW---GGFVEFFREDDSESR----
A0A3Q3VP02_MCL1-01      DRVELVAHEISTYLLTDQRDWMCV--GG---DGFVEFFRVADPEST----
A0A3B5K5B3_MCL1-01      DCVEPVAQEISTYLLTDRRDWLIKNNGW---EGFVEFFQVSDPESS----
A0A3B3IJ04_MCL1-01      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT----
A0A3P9L1F3_MCL1-01      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPEST----
A0A3B3IJ04_MCL1-02      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT----
A0A3P9L1F3_MCL1-02      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPEST----
A0A3B3CEX1_MCL1-02      HSVDLVSQEICTYLLREQRDWLINNNSW---DGFVEFFHVPDPEST----
A0A3B3CEX1_MCL1-01      HSVDLVSQEICTYLLREQRDWLINNNSW---DGFVEFFHVPDPEST----
A0A3Q3B4P5_MCL1-01      ECVELVGQEISTYLLSEQKDWLLKNNSW---SGFVEFFRITDPEST----
A0A3Q3B4P5_MCL1-02      ECVELVGQEISTYLLSEQKDWLLKNNSW---SGFVEFFRITDPEST----
A0A3Q2EDX8_MCL1-01      NCVELVSQEISTYLLQNQRDWLVKNNSW---NGFVEFFRVEDPEAT----
A0A3Q2P7X9_MCL1-01      HCVDLVSREISTYLLTNQRDWLAKNNSW---DGFVEFFKVEDTEST----
A0A3Q2P7X9_MCL1-02      HCVDLVSREISTYLLTNQRDWLAKNNSW---DGFVEFFKVEDTEST----
A0A3B5PQ55_MCL1-02      HCVELVSRKISTYLLANQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A3B5PQ55_MCL1-01      HCVELVSRKISTYLLANQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A3P9Q4I8_MCL1-02      HCVDLVSQEISTYLLAKQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A3P9Q4I8_MCL1-01      HCVDLVSQEISTYLLAKQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A087X830_MCL1-01      HCVELVSKEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A3B3YCD0_MCL1-01      HCVELVSKEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST----
I3JHR5_MCL1-01          NCVALVSQEVSAYLLSEQRDWIVKNNAW---DGFVEFFRVADPEST----
A0A3Q4HLQ8_MCL1-01      NCVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A3P8NP63_MCL1-02      NYVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A3Q2VNL8_MCL1-01      NYVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A3P8NP63_MCL1-01      NYVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A3P9BVM3_MCL1-01      NYVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A3B4G4Z6_MCL1-01      NYVALVSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI----
A0A2U9CJ81_MCL1-01      NCVELVGQEISTYLLTDQRDWLVKNNSW---EGFVEFFRVADPETT----
A0A3P8VKM5_MCL1-05      NSTELVGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT----
A0A3P8VKM5_MCL1-04      NSTELVGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT----
A0A3P8VKM5_MCL1-03      NSTELVGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT----
A0A3Q3IZW0_MCL1-01      NCVELVGQEISTYLLSHQRDWLVKNNAW---DGFEEFFRVADPEST----
A0A3Q1GX28_MCL1-02      NCVDLVAQEISSYLLSAQRDWLVRNNSW---DGFVEFFRVADPEST----
A0A3Q1GX28_MCL1-01      NCVDLVAQEISSYLLSAQRDWLVRNNSW---DGFVEFFRVADPEST----
A0A3B4XKA5_MCL1-01      NCVESVGQEISKYLLSDQRDWLVKNNSW---DGFVSFFRVADPESK----
A0A3Q3GP42_MCL1-01      HCVELVGQEISTYLLSDHRDWLVKNNAW---DGFVEFFRVADPEST----
A0A3Q3M6G2_MCL1-01      DCVELVGQEISTYLLSDQRDWLVKNNSW---DGFVEFFRVADPEST----
A0A3Q3M6G2_MCL1-02      DCVELVGQEISTYLLSDQRDWLVKNNSW---DGFVEFFRVADPEST----
A0A3B4AFB7_MCL1-01      SCVERVGQEISSYLLLDQRDWLVRNNAW---DGFVDFFRVEDPESA----
Q8UWD6_MCL1-01          KYVRLVGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA----
A2BF68_MCL1-01          KYVRLVGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA----
Q568W5_MCL1-01          KYVRLVGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA----
A0A3B1K5R1_MCL1-01      HCVSLVGEELSSYLLSDERDWLLKNKAW---DGFVEFFRVPDPEST----
A0A3B4C6H5_MCL1-01      HCVSLVGQEISSYLLSDQKDWLLKNKAW---DGFVEFFHVPDPESK----
A0A3B4C6H5_MCL1-03      HCVSLVGQEISSYLLSDQKDWLLKNKAW---DGFVEFFHVPDPESK----
Q568V1_MCL1-01          QCVERVAEQISSYLTSEQQDWILKNKSC---HGFVEFFHQEDVESV----
Q1L8X3_MCL1-01          QCVERVAEQISSYLTSEQQDWILKNKSW---HGFVEFFHQEDVESV----
Q9I9N3_MCL1-01          QCVERVAEQISSYLTSEQQDWILKNKSW---HGFVEFFHQEDVESV----
W5MMB7_MCL1-01          SCVEAVGQAISNYLLQDQREWLLNNRGW---DGFVEFFRVEDPEST----
A0A3B3R4U0_MCL1-01      NCVDDVASRISCYLLEHQRDWLNRNNGW---EGFTDFFYMEDPEST----
A0A3B3SG34_MCL1-01      HCVEAVGKQISSYLLSEQRQWLLKNKAW---DGFVEFFHVEDTESL----
A0A3Q2Y539_MCL1-01      RCVELVAQEVSTYLLSHQRTWLVQHNGW---DGFAEFFKEDDLEST----
Q4SW32_MCL1-01          DCVEQVAQEISTYLLTDQRDWLIKNNAW---DGFVEFFQVPDPEST----
D2ITA0_MCL1-03          GCVSLVAEEISSYLLSDQREWLVKNNSW---EGFVEFFRVSDPETT----
D2ITA0_MCL1-04          GCVSLVAEEISSYLLSDQREWLVKNNSW---EGFVEFFRVSDPETT----
A0A3P9ILF6_MCL1-01      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT----
A0A3P9ILF6_MCL1-02      HCVDLVSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT----
Q0KFR9_MCL1-01          HCVELVGQEIAKYLLSDQSDWLIKNNAW---NGFVEFFHVQDPESS----
A0A3P8Y1W8_MCL1-02      NCVELVGQEISTYLLTDQRAWLVKNNAW---DGFVEFFHVEDPESS----
A0A3P8Y1W8_MCL1-01      NCVELVGQEISTYLLTDQRAWLVKNNAW---DGFVEFFHVEDPESS----
A0A3Q2XZL8_MCL1-01      HCVEPVADEISSYLLSHQRNWLVKNNSW---DGFVQFFREVDPEST----
A0A3B4AFB7_MCL1-02      SCVERVGQEISSYLLLDQRDWLVRNNAW---DGFVDFFRVEDPESA----
A0A3B3VM25_MCL1-01      HCVELVIQEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST----
A0A3Q0R633_MCL1-01      NCVELVSQEISTYLLSDQRDWLVKNNAW---DGFVEFFRVADPEST----
A0A3Q0R633_MCL1-03      NCVELVSQEISTYLLSDQRDWLVKNNAW---DGFVEFFRVADPEST----
A0A3B4T8L9_MCL1-02      NCVESVGQEISKYLLSDQRDWLVKNNSW---DGFVAFFRVADPESK----
A0A3B4T8L9_MCL1-01      NCVESVGQEISKYLLSDQRDWLVKNNSW---DGFVAFFRVADPESK----
A0A3Q1EQB9_MCL1-02      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3B4ZKP6_MCL1-01      NCVDLVSEEISTYLLCDQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3Q1BKL8_MCL1-02      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3Q1EQB9_MCL1-01      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3Q1BKL8_MCL1-01      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3P8RQX7_MCL1-01      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
A0A3P8RQX7_MCL1-02      NCVDLVSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT----
                                                                          

I3KXG5_MCL1-01          --------VRNTLMAFAGFACIGATLALL-----------------IR--
A2BF68_MCL1-02          --------VRNTLLTIGGVATLSAALAYW-----------------IR--
A0A2K5DMS4_MCL1-01      --------IRNGLLAFAGVAGVGTDLAYL-----------------IR--
A0A3P8V8T6_MCL1-01      --------IRCTLLGFVGFAGLWATLALL-----------------MRYF
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------IRNVLMAFAGVAGLGASLAYM-----------------IR--
K7FPN7_MCL1-01          --------IRNVLVAFAGFAGLGASLAYM-----------------MR--
H3AR18_MCL1-02          --------IKNVLMTFAGVAGLGASLVYL-----------------MR--
H3AR18_MCL1-01          --------IKNVLMTFAGVAGLGASLVYL-----------------MR--
J7H260_MCL1-01          --------LKTVLMAFAGVAGLGASLAYM-----------------IR--
G1PZ39_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
Q9Z1P3_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A5PJR2_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A452GA25_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
G1L3L7_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
G1T2Q0_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F7AVA6_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A337S3J9_MCL1-01      --------DKA---------------------------------------
A0A337S3J9_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
Q7YRZ9_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F1PAP1_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
Q8HYS5_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
M3XZZ5_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A452RHX5_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
H0XFB7_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F7GTF7_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5CFH3_MCL1-01      --------IRNVLLAFAGVAGVGAGLALS-----------------LIHI
A0A2K6V5Y3_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K6KRW9_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5XSB2_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A0D9RZP5_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
I7G687_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5LXU8_MCL1-01      --------IRNVLLAVAGVAGVGAGLAYL-----------------IR--
A0A2I3GJZ3_MCL1-02      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
H2N5Y9_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2R9BPJ5_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2I3RTV4_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2I2YQH7_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5C7L5_MCL1-01      --------------------GISNKIAL----------------------
A0A2K5I9I0_MCL1-02      --------------------GISNQIALL---------------------
A0A2K6GI15_MCL1-01      --------------------GISNKIAL----------------------
A0A2I3GJZ3_MCL1-01      --------------------GISNKIALL---------------------
A0A2K5CFH3_MCL1-03      --------------------G-----------------------------
A0A2K5R5E2_MCL1-03      --------------------GISNKIAL----------------------
A0A2K5W0W9_MCL1-01      --------------------GISNKIALL---------------------
A0A2K6ECR0_MCL1-02      --------------------GISNKIALL---------------------
A0A2I3LFM0_MCL1-01      --------------------GISNKIALL---------------------
A0A2K6KRW9_MCL1-02      --------------------GISNKIALL---------------------
A0A2K6PPI3_MCL1-02      --------------------GISNKIALL---------------------
Q95KR3_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5EPX0_MCL1-02      --------IRNVLLAFACVAGVGAGLAYL-----------------IR--
A0A2K5EPX0_MCL1-01      --------IRNVLLAFACVAGVGAGLAYL-----------------IR--
G3WBC5_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
W5QI41_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F1MQX4_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A287BK44_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
B4DLY8_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
B4DG83_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
B4E3L8_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
B6V6J0_MCL1-01          --------LKTVLMAFSSVAVLGAGLAYM-----------------IR--
G3PJT0_MCL1-01          --------VRNTLMAVAGFASIGATLALL-----------------ISGP
H0XHA5_MCL1-01          --------VRNVLLAFAGVAGVGAGLTYL-----------------IR--
A0A2K6F6N9_MCL1-01      --------IRNVLLAFAGVAGVGAGLTYL-----------------IR--
G1QAV8_MCL1-01          --------VRNVLLAFAG-AGVGAGLPYL-----------------IR--
H9GEA6_MCL1-02          --------IRNVLVAFASVAGIGAGLAYM-----------------IR--
H9GEA6_MCL1-01          --------------------------------------------------
A0A493U0E8_MCL1-01      --------IRNVLMAFAGVAGLGASLAYM-----------------IR--
A0A1L1RNM6_MCL1-01      --------IRNVLMAFAGVAGLGASLAYM-----------------IRKW
A0A1L1RNM6_MCL1-02      --------IRNVLMAFAGVAGLGASLAYM-----------------IR--
G2HFR3_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F6ZMX1_MCL1-01          PSSAYLLLCAEPLFWWCQLTASGCHVPDK-----------------PRNV
F6ZMX1_MCL1-03          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F6ZMX1_MCL1-02          --------N-----------------------------------------
G1T2Q0_MCL1-02          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F1PAP1_MCL1-02          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A337S3J9_MCL1-04      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
F7AVA6_MCL1-02          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K6GI15_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
C8YZ26_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------KR--
F7GTF7_MCL1-02          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5R5E2_MCL1-04      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K6V5Y3_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5LXU8_MCL1-03      --------IRNVLLAVAGVAGVGAGLAYL-----------------IR--
A0A2K5I9I0_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2I2YQH7_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
Q07820_MCL1-04          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5W0W9_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K6ECR0_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K5XSB2_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2R9BPJ5_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2I3RTV4_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2I3LFM0_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A2K6PPI3_MCL1-03      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A286Y1M5_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
B4DU51_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A287DCH9_MCL1-02      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
P97287_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A452GA25_MCL1-02      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A287DCH9_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
G3T756_MCL1-01          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A1S3F3I1_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
G1L3L7_MCL1-02          --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A287BK44_MCL1-01      --------IRNVLLAFAGVAGVGAGLAYL-----------------IR--
A0A287BK44_MCL1-02      --------IRSNKIAF----------------------------------
A0A3B1IEV7_MCL1-01      --------VRNALMAFAGFAGLGAGLALL-----------------MR--
A0A3B4CGU9_MCL1-03      --------VRNALMAFAGFAGLGAGLALL-----------------MR--
A0A3B4CGU9_MCL1-02      --------VRNALMAFAGFAGLGAGLALL-----------------MR--
A0A3Q3VP02_MCL1-01      --------VRNALMTIAGVAGIGATLALL-----------------IR--
A0A3B5K5B3_MCL1-01      --------VRNMLMAVAGVAGLGATLALL-----------------IR--
A0A3B3IJ04_MCL1-01      --------VRNTLVAFLGIAGVGALLAQL-----------------SR--
A0A3P9L1F3_MCL1-01      --------VRNTLVAFLGIAGVGALLAQL-----------------SR--
A0A3B3IJ04_MCL1-02      --------VRNTLVAFLGIAGVGALLAQL-----------------NMMA
A0A3P9L1F3_MCL1-02      --------VRNTLVAFLGIAGVGALLAQL-----------------NMMA
A0A3B3CEX1_MCL1-02      --------VRNTLVAVLGLAGVGALLAQV---------------------
A0A3B3CEX1_MCL1-01      --------VRNTLVAVLGLAGVGALLAQV-----------------QGPY
A0A3Q3B4P5_MCL1-01      --------VRNTLMAVAGFAGLGATLALL-----------------ISV-
A0A3Q3B4P5_MCL1-02      --------VRNTLMAVAGFAGLGATLALL-----------------ISTW
A0A3Q2EDX8_MCL1-01      --------MRNTLMAFVGVAGIGATLAFL-----------------IR--
A0A3Q2P7X9_MCL1-01      --------VRNTLMAFVGVAGIGAGLAFL-----------------IRNS
A0A3Q2P7X9_MCL1-02      --------VRNTLMAFVGVAGIGAGLAFL-----------------IR--
A0A3B5PQ55_MCL1-02      --------VRNTLMAVVGVAGIGATLAFL-----------------I---
A0A3B5PQ55_MCL1-01      --------VRNTLMAVVGVAGIGATLAFL-----------------IRRC
A0A3P9Q4I8_MCL1-02      --------VRNTLMAFVGVAGIGATLAFL-----------------IR--
A0A3P9Q4I8_MCL1-01      --------VRNTLMAFVGVAGIGATLAFL-----------------ISK-
A0A087X830_MCL1-01      --------VRNTLMAFVGVAGIGATLAFL-----------------IR--
A0A3B3YCD0_MCL1-01      --------VRNTLMAFVGVAGIGATLAFL-----------------IR--
I3JHR5_MCL1-01          --------VRNTLMAFAGFAGIGATLALL-----------------IRFW
A0A3Q4HLQ8_MCL1-01      --------VRHTLMAFAGFAGIGATLALL-----------------IR--
A0A3P8NP63_MCL1-02      --------VRHTLMAFAGFAGIGATLALL-----------------IRSS
A0A3Q2VNL8_MCL1-01      --------VRHTLMAFAGFAGIGATLALL-----------------ISGL
A0A3P8NP63_MCL1-01      --------VRHTLMAFAGFAGIGATLALL-----------------ISCW
A0A3P9BVM3_MCL1-01      --------VRHTLMAFAGFAGIGATLALL-----------------ISCW
A0A3B4G4Z6_MCL1-01      --------VRHTLMAFAGFAGIGATLALL-----------------ISCW
A0A2U9CJ81_MCL1-01      --------MRNTLIGLAGFAGVGATLALL-----------------IR--
A0A3P8VKM5_MCL1-05      --------MRNTLLGLFGVAGLGATLALL-----------------IRWK
A0A3P8VKM5_MCL1-04      --------MRNTLLGLFGVAGLGATLALL-----------------IR--
A0A3P8VKM5_MCL1-03      --------MRNTLLGLFGVAGLGATLALL-----------------IR--
A0A3Q3IZW0_MCL1-01      --------VRTTLMAFAGFAGIGATLALL-----------------IRTN
A0A3Q1GX28_MCL1-02      --------VRKSLMAFAGLAGIGASLALL-----------------ISAV
A0A3Q1GX28_MCL1-01      --------VRKSLMAFAGLAGIGASLALL-----------------ISSC
A0A3B4XKA5_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------ISAM
A0A3Q3GP42_MCL1-01      --------VRTTLMAFAGFAGIGATLALL-----------------IR--
A0A3Q3M6G2_MCL1-01      --------VRHTLMAVAGVAGLGATLALL-----------------ISRN
A0A3Q3M6G2_MCL1-02      --------VRHTLMAVAGVAGLGATLALL-----------------ISYC
A0A3B4AFB7_MCL1-01      --------VRNTLMAVAGLAGIGATLAML-----------------IR--
Q8UWD6_MCL1-01          --------VRNTLLTIGSVATLSAALAYW-----------------IR--
A2BF68_MCL1-01          --------VRNTLLTIGGVATLSAALAYW-----------------IR--
Q568W5_MCL1-01          --------VRNTLLTIGGVATLSAALAYW-----------------IR--
A0A3B1K5R1_MCL1-01      --------MRNALMAFVTVAGLGASIAFL-----------------AR--
A0A3B4C6H5_MCL1-01      --------MRNALMALVTAAGVGAGLVLL-----------------SR--
A0A3B4C6H5_MCL1-03      --------MRNALMALVTAAGVGAGLVLL-----------------SR--
Q568V1_MCL1-01          --------VRHGLLALVGCAGIGAGLAFL-----------------IR--
Q1L8X3_MCL1-01          --------VRHGLLALVGCAGIGAGLAFL-----------------IR--
Q9I9N3_MCL1-01          --------VRHGLLALVGCAGIGAGLAFL-----------------IR--
W5MMB7_MCL1-01          --------IRNALMAFAGVAGLGAGLALL-----------------IR--
A0A3B3R4U0_MCL1-01      --------VRNALVAFAGVASLGAGLALL-----------------MR--
A0A3B3SG34_MCL1-01      --------VLQKVLVHVSECGSFELHDLKALCM-----------------
A0A3Q2Y539_MCL1-01      --------VRNGLFAFVGLVSVTAALRCL-----------------IR--
Q4SW32_MCL1-01          --------VRTVLMAVAGVAGIGAKLALL-----------------IR--
D2ITA0_MCL1-03          --------VRNTLMAFAGFAGIGATIALL-----------------IR--
D2ITA0_MCL1-04          --------VRNTLMAFAGFAGIGATIALL-----------------IR--
A0A3P9ILF6_MCL1-01      --------VRNTLVAFLGIAGVGALLAQL-----------------SR--
A0A3P9ILF6_MCL1-02      --------VRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASARLHNSR--
Q0KFR9_MCL1-01          --------VRNTLLAFAGVAGIGATLAMF-----------------IR--
A0A3P8Y1W8_MCL1-02      --------------------PIGLFLQVF---------------------
A0A3P8Y1W8_MCL1-01      --------VRNTLMAFAGVAGIGATLALL-----------------IR--
A0A3Q2XZL8_MCL1-01      --------VRNTLMAFAGVAGIGATLALL-----------------IR--
A0A3B4AFB7_MCL1-02      --------VRNTLMAVAGLAGIGATLAML-----------------IR--
A0A3B3VM25_MCL1-01      --------VRNTLMAFVGVAGIGATLAFL-----------------IRKL
A0A3Q0R633_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
A0A3Q0R633_MCL1-03      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
A0A3B4T8L9_MCL1-02      --------VRNTLMAFAGFAGIGATLALL-----------------IRCL
A0A3B4T8L9_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------ISAM
A0A3Q1EQB9_MCL1-02      --------VRNTLMAFAGFAGIGATLALL-----------------IRLE
A0A3B4ZKP6_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------IRS-
A0A3Q1BKL8_MCL1-02      --------VRNTLMAFAGFAGIGATLALL-----------------ISGL
A0A3Q1EQB9_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
A0A3Q1BKL8_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
A0A3P8RQX7_MCL1-01      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
A0A3P8RQX7_MCL1-02      --------VRNTLMAFAGFAGIGATLALL-----------------IR--
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      LRFVW---------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
F1PAP1_MCL1-01          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          SKVQRQLLTIELLQIVRSQRGGHRLQRDVSTRPSPTSGSGL---------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          --------------------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      RS------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          LTEERKWAASLQRSHNKFSTSMITHGL-----------------------
F6ZMX1_MCL1-03          --------------------------------------------------
F6ZMX1_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
A0A1S3F3I1_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      IFKGLPASTRLHNSR-----------------------------------
A0A3P9L1F3_MCL1-02      IFKGLPASARLHNWR-----------------------------------
A0A3B3CEX1_MCL1-02      --------CR----------------------------------------
A0A3B3CEX1_MCL1-01      RIWQDMTSCHTNLSKNKVGRSPSFAVEGP---------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      SAKCEHRPLENESCVSLAPGIRSCYLSTTTHLSWAAEIWAAGVDQQDESN
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      IKISFIGQDCSWAFTSPPTFPGL---------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --SF----------------------------------------------
A0A3B5PQ55_MCL1-01      KEKY----------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-01          DALL----------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      TIF-----------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      DALL----------------------------------------------
A0A3P9BVM3_MCL1-01      DALL----------------------------------------------
A0A3B4G4Z6_MCL1-01      DALL----------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      NTCGGLKRKWSRASPW----------------------------------
A0A3Q1GX28_MCL1-02      RLQPLHLH------------------------------------------
A0A3Q1GX28_MCL1-01      SVM-----------------------------------------------
A0A3B4XKA5_MCL1-01      M-------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      NKMLTSQSAISAPVSA----------------------------------
A0A3Q3M6G2_MCL1-02      GVM-----------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      RSALGQQKLNTSLLEMRDCTSLEPG-------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      FERSRPKQEGKIAFFPMSCSREAHFHRAHS--------------------
A0A3B4T8L9_MCL1-01      M-------------------------------------------------
A0A3Q1EQB9_MCL1-02      SKFGETQRTGRGAGGKRWIQGGRRKPQERNRRRHDACRDRGRGQGNRQNW
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      AAVGLTQSTENSCKDAHISCCR----------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
                                                                          

I3KXG5_MCL1-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
F1PAP1_MCL1-01          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          --------------------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-03          --------------------------------------------------
F6ZMX1_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
A0A1S3F3I1_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      ------------CWP-----------------------------------
A0A3Q3B4P5_MCL1-02      LNIGWILPLHNDCWRQAPAPCVSAGKRE----------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      RVPRRGNQEGHGAGRGPRRKQGDRLGRSGPDSGILQERRTEKKTLVSEIL
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
                                                                          

I3KXG5_MCL1-01          --
A2BF68_MCL1-02          --
A0A2K5DMS4_MCL1-01      --
A0A3P8V8T6_MCL1-01      --
U3KKY6_MCL1-01          --
G1MPY7_MCL1-01          --
K7FPN7_MCL1-01          --
H3AR18_MCL1-02          --
H3AR18_MCL1-01          --
J7H260_MCL1-01          --
G1PZ39_MCL1-01          --
Q9Z1P3_MCL1-01          --
A5PJR2_MCL1-01          --
A0A452GA25_MCL1-01      --
G1L3L7_MCL1-01          --
G1T2Q0_MCL1-01          --
F7AVA6_MCL1-01          --
A0A337S3J9_MCL1-01      --
A0A337S3J9_MCL1-03      --
Q7YRZ9_MCL1-01          --
F1PAP1_MCL1-01          --
Q8HYS5_MCL1-01          --
M3XZZ5_MCL1-01          --
A0A452RHX5_MCL1-01      --
H0XFB7_MCL1-01          --
F7GTF7_MCL1-01          --
A0A2K5CFH3_MCL1-01      --
A0A2K6V5Y3_MCL1-01      --
A0A2K6KRW9_MCL1-01      --
A0A2K5XSB2_MCL1-01      --
A0A0D9RZP5_MCL1-01      --
I7G687_MCL1-01          --
A0A2K5LXU8_MCL1-01      --
A0A2I3GJZ3_MCL1-02      --
H2N5Y9_MCL1-01          --
A0A2R9BPJ5_MCL1-01      --
A0A2I3RTV4_MCL1-01      --
A0A2I2YQH7_MCL1-01      --
A0A2K5C7L5_MCL1-01      --
A0A2K5I9I0_MCL1-02      --
A0A2K6GI15_MCL1-01      --
A0A2I3GJZ3_MCL1-01      --
A0A2K5CFH3_MCL1-03      --
A0A2K5R5E2_MCL1-03      --
A0A2K5W0W9_MCL1-01      --
A0A2K6ECR0_MCL1-02      --
A0A2I3LFM0_MCL1-01      --
A0A2K6KRW9_MCL1-02      --
A0A2K6PPI3_MCL1-02      --
Q95KR3_MCL1-01          --
A0A2K5EPX0_MCL1-02      --
A0A2K5EPX0_MCL1-01      --
G3WBC5_MCL1-01          --
W5QI41_MCL1-01          --
F1MQX4_MCL1-01          --
A0A287BK44_MCL1-03      --
B4DLY8_MCL1-01          --
B4DG83_MCL1-01          --
B4E3L8_MCL1-01          --
B6V6J0_MCL1-01          --
G3PJT0_MCL1-01          --
H0XHA5_MCL1-01          --
A0A2K6F6N9_MCL1-01      --
G1QAV8_MCL1-01          --
H9GEA6_MCL1-02          --
H9GEA6_MCL1-01          --
A0A493U0E8_MCL1-01      --
A0A1L1RNM6_MCL1-01      --
A0A1L1RNM6_MCL1-02      --
G2HFR3_MCL1-01          --
F6ZMX1_MCL1-01          --
F6ZMX1_MCL1-03          --
F6ZMX1_MCL1-02          --
G1T2Q0_MCL1-02          --
F1PAP1_MCL1-02          --
A0A337S3J9_MCL1-04      --
F7AVA6_MCL1-02          --
A0A2K6GI15_MCL1-03      --
C8YZ26_MCL1-01          --
F7GTF7_MCL1-02          --
A0A2K5R5E2_MCL1-04      --
A0A2K6V5Y3_MCL1-03      --
A0A2K5LXU8_MCL1-03      --
A0A2K5I9I0_MCL1-03      --
A0A2I2YQH7_MCL1-03      --
Q07820_MCL1-04          --
A0A2K5W0W9_MCL1-03      --
A0A2K6ECR0_MCL1-03      --
A0A2K5XSB2_MCL1-03      --
A0A2R9BPJ5_MCL1-03      --
A0A2I3RTV4_MCL1-03      --
A0A2I3LFM0_MCL1-03      --
A0A2K6PPI3_MCL1-03      --
A0A286Y1M5_MCL1-01      --
B4DU51_MCL1-01          --
A0A287DCH9_MCL1-02      --
P97287_MCL1-01          --
A0A452GA25_MCL1-02      --
A0A287DCH9_MCL1-01      --
G3T756_MCL1-01          --
A0A1S3F3I1_MCL1-01      --
G1L3L7_MCL1-02          --
A0A287BK44_MCL1-01      --
A0A287BK44_MCL1-02      --
A0A3B1IEV7_MCL1-01      --
A0A3B4CGU9_MCL1-03      --
A0A3B4CGU9_MCL1-02      --
A0A3Q3VP02_MCL1-01      --
A0A3B5K5B3_MCL1-01      --
A0A3B3IJ04_MCL1-01      --
A0A3P9L1F3_MCL1-01      --
A0A3B3IJ04_MCL1-02      --
A0A3P9L1F3_MCL1-02      --
A0A3B3CEX1_MCL1-02      --
A0A3B3CEX1_MCL1-01      --
A0A3Q3B4P5_MCL1-01      --
A0A3Q3B4P5_MCL1-02      --
A0A3Q2EDX8_MCL1-01      --
A0A3Q2P7X9_MCL1-01      --
A0A3Q2P7X9_MCL1-02      --
A0A3B5PQ55_MCL1-02      --
A0A3B5PQ55_MCL1-01      --
A0A3P9Q4I8_MCL1-02      --
A0A3P9Q4I8_MCL1-01      --
A0A087X830_MCL1-01      --
A0A3B3YCD0_MCL1-01      --
I3JHR5_MCL1-01          --
A0A3Q4HLQ8_MCL1-01      --
A0A3P8NP63_MCL1-02      --
A0A3Q2VNL8_MCL1-01      --
A0A3P8NP63_MCL1-01      --
A0A3P9BVM3_MCL1-01      --
A0A3B4G4Z6_MCL1-01      --
A0A2U9CJ81_MCL1-01      --
A0A3P8VKM5_MCL1-05      --
A0A3P8VKM5_MCL1-04      --
A0A3P8VKM5_MCL1-03      --
A0A3Q3IZW0_MCL1-01      --
A0A3Q1GX28_MCL1-02      --
A0A3Q1GX28_MCL1-01      --
A0A3B4XKA5_MCL1-01      --
A0A3Q3GP42_MCL1-01      --
A0A3Q3M6G2_MCL1-01      --
A0A3Q3M6G2_MCL1-02      --
A0A3B4AFB7_MCL1-01      --
Q8UWD6_MCL1-01          --
A2BF68_MCL1-01          --
Q568W5_MCL1-01          --
A0A3B1K5R1_MCL1-01      --
A0A3B4C6H5_MCL1-01      --
A0A3B4C6H5_MCL1-03      --
Q568V1_MCL1-01          --
Q1L8X3_MCL1-01          --
Q9I9N3_MCL1-01          --
W5MMB7_MCL1-01          --
A0A3B3R4U0_MCL1-01      --
A0A3B3SG34_MCL1-01      --
A0A3Q2Y539_MCL1-01      --
Q4SW32_MCL1-01          --
D2ITA0_MCL1-03          --
D2ITA0_MCL1-04          --
A0A3P9ILF6_MCL1-01      --
A0A3P9ILF6_MCL1-02      --
Q0KFR9_MCL1-01          --
A0A3P8Y1W8_MCL1-02      --
A0A3P8Y1W8_MCL1-01      --
A0A3Q2XZL8_MCL1-01      --
A0A3B4AFB7_MCL1-02      --
A0A3B3VM25_MCL1-01      --
A0A3Q0R633_MCL1-01      --
A0A3Q0R633_MCL1-03      --
A0A3B4T8L9_MCL1-02      --
A0A3B4T8L9_MCL1-01      --
A0A3Q1EQB9_MCL1-02      VT
A0A3B4ZKP6_MCL1-01      --
A0A3Q1BKL8_MCL1-02      --
A0A3Q1EQB9_MCL1-01      --
A0A3Q1BKL8_MCL1-01      --
A0A3P8RQX7_MCL1-01      --
A0A3P8RQX7_MCL1-02      --
                          

© 1998-2020Legal notice