Dataset for protein Mcl-1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

181 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          ------------------------MSFLAQGVQTPTLKTC----------
Q1L8X3_MCL1-01          ----------MALS--LDFRRTATMSFFAQGVQTPTLKTC----------
Q9I9N3_MCL1-01          ----------MALS--LDFRRTATMSFFAQGVQTPTLKTC----------
W5MMB7_MCL1-01          ------MSLSSLKR--TSASAVIQLYCPNATTIHPGLASL--------GP
A0A3B3R4U0_MCL1-01      ----MNLINRTTAT--GLFCPGIKNGVKQNGFYSF-------------VS
A0A3B3SG34_MCL1-01      ----MNPQSLKSYA--PIMVSMNYHRPLHHGVLGKSILQC---LDSSARA
A0A3Q2Y539_MCL1-01      ---MPESKRFPLYN--FKVGLVDALMLPPKAVVQGSMASQ----------
Q4SW32_MCL1-01          -------MSVIANR--TAIDTMNVMF--QNGVGD--------------AD
Q0KFR9_MCL1-01          ---------MSLSN--SITRATTTMLHFQNGGSSYLADDARPLYYFQGAG
A0A3P8Y1W8_MCL1-02      ---------MNLSK--SLTRATTTMLNVQNGVVGSLYSGA-PLCYFSPTG
A0A3P8Y1W8_MCL1-01      ---------MNLSK--SLTRATTTMLNVQNGVVGSLYSGA-PLCYFSPTG
D2ITA0_MCL1-03          ---MLSQKLTSNYG--TSLVQTCWFNSPQNGGEERNMDFH--------SE
D2ITA0_MCL1-04          ---MLSQKLTSNYG--TSLVQTCWFNSPQNGGEERNMDFH--------SE
A0A3P9ILF6_MCL1-02      ------------MF--PLQKQMVNSYITSNCGFTGHILGR--------AG
A0A3P9ILF6_MCL1-01      ------------MF--PLQKQMVNSYITSNCGFTGHILGR--------AG
A0A3Q2XZL8_MCL1-01      ----MSMVQ--PTS--QVLKPQGRPMRPQNGVAEGLLQCN--------SP
A0A3B4AFB7_MCL1-02      ----MNIINSPKRT--ALKLSTMGLFLPQNGLAEGDMHCG--------AA
A0A3B3VM25_MCL1-01      -----------MTA--NSTTALNYLIFSQNGVGDGQTHYD--------QG
I3KXG5_MCL1-01          ------------------MFSLNCCL----------SEWC--------PN
A0A3Q0R633_MCL1-01      -----------------------------------SLPF-----------
A0A3Q0R633_MCL1-03      ---MNTCTMRNCRM--GSYKNVMDLFLPQNGVVDGTMHYG--------SG
A0A3B4T8L9_MCL1-02      ----MNLIQ-SPKP--TAFTAMNYCICRQNGGLETWTD-G--------SG
A0A3B4T8L9_MCL1-01      ----MNLIQ-SPKP--TAFTAMNYCICRQNGGLETWTD-G--------SG
A0A3Q1EQB9_MCL1-02      ----MNMIP--TKR--TTL--MNCLIFPQNGVVEGPMHYG--------SG
A0A3B4ZKP6_MCL1-01      ----MNIIP-TTKR--TAL--MSCFILPQNGVVEGQMHYG--------SG
A0A3Q1BKL8_MCL1-02      ----MNMIPTTTKR--TAF--MNYLIFPQNGVVEGPMHYG--------SG
A0A3Q1EQB9_MCL1-01      ----MNMIP--TKR--TTL--MNCLIFPQNGVVEGPMHYG--------SG
A0A3Q1BKL8_MCL1-01      ----MNMIPTTTKR--TAF--MNYLIFPQNGVVEGPMHYG--------SG
A0A3P8RQX7_MCL1-02      ----MNMIPTTTKR--TAF--MNYLIFPQNGVVEGPMHYG--------SG
A0A3P8RQX7_MCL1-01      ----MNMIPTTTKR--TAF--MNYLIFPQNGVVEGPMHYG--------SG
G3PJT0_MCL1-01          --MNIIQRPKLAAL--NMTGVMSCIILPQNGVAP----------------
A0A3B3IJ04_MCL1-01      -----------MFP--LQKQMVNSYITSNCGFTGHILGSR--------AG
A0A3P9L1F3_MCL1-01      -----------MFP--LQKQMVNSYITSNCGFTGHILGSR--------AG
A0A3B3IJ04_MCL1-02      -----------MFP--LQKQMVNSYITSNCGFTGHILGSR--------AG
A0A3P9L1F3_MCL1-02      -----------MFP--LQKQMVNSYITSNCGFTGHILGSR--------AG
A0A3B3CEX1_MCL1-01      -----------MLP--LQKHMVNSYITPSCGCTALFGG----------AG
A0A3B3CEX1_MCL1-02      -----------MLP--LQKHMVNSYITPSCGCTALFGG----------AG
A0A3Q3VP02_MCL1-01      -----------------------MNVLFQNGVVSGPTR------------
A0A3Q3B4P5_MCL1-01      -------------M--FPKPKPSYIFFLQNGVVDGLHR------------
A0A3Q3B4P5_MCL1-02      -------------M--FPKPKPSYIFFLQNGVVDGLHR------------
A0A3Q2EDX8_MCL1-01      ---------------------MSYLILPQNGVVDGQTHYS--------PE
A0A3Q2P7X9_MCL1-01      ----------MSKA--PTSTQLVNCLISQNGVGDGQPHYR--------PG
A0A3Q2P7X9_MCL1-02      ----------MSKA--PTSTQLVNCLISQNGVGDGQPHYR--------PG
A0A3B5PQ55_MCL1-01      -----------MTA--NSTNALNYLIFSQNGVGNGQTHYD--------QG
A0A3B5PQ55_MCL1-02      -----------MTA--NSTNALNYLIFSQNGVGNGQTHYD--------QG
A0A3P9Q4I8_MCL1-01      -----------MTA--NSTTALNYLIFSQNGVGNGQTHYD--------QG
A0A3P9Q4I8_MCL1-02      -----------MTA--NSTTALNYLIFSQNGVGNGQTHYD--------QG
A0A087X830_MCL1-01      -----------MTA--NSTTALNYLIFSQNGVGDGQTHYD--------QG
A0A3B3YCD0_MCL1-01      -----------MTA--NSTTALNYLIFSQNGVGDGQTHYD--------QG
I3JHR5_MCL1-02          MTNFLMS-KRNQCT-------FIDYLLPQNGVLEGPMHYG--------SG
I3JHR5_MCL1-03          MTNFLMS-KRNQCT-------FIDYLLPQNGVLEGPMHYG--------SG
I3JHR5_MCL1-01          MTNFLMS-KRNQCT-------FIDYLLPQNGVLEGPMHYG--------SG
A0A3Q4HLQ8_MCL1-01      MTNYMMS-KRNQCT-------FIDYLIPQNGVLEGPMHYG--------SG
A0A3P8NP63_MCL1-02      MANYMML-KRNQCT-------LMEYLIPQNGVLEGPMHYG--------SG
A0A3Q2VNL8_MCL1-01      MANYMML-KRNQCT-------LMEYLIPQNGVLEGPMHYG--------SG
A0A3P8NP63_MCL1-01      MANYMML-KRNQCT-------LMEYLIPQNGVLEGPMHYG--------SG
A0A3P9BVM3_MCL1-01      MANYMML-KRNQCT-------LMEYLIPQNGVLEGPMHYG--------SG
A0A3B4G4Z6_MCL1-01      MANYMML-KRNQCT-------LMEYLIPQNGVLEGPMHYG--------SG
A0A2U9CJ81_MCL1-01      -MNIIPSTKRAAFN--VTTGVMGCLILPQNGVVEGAMHYG--------SG
A0A3P8VKM5_MCL1-03      -MNIIKN-NQAKLN--VATGVLGCFIVPQNGVVNGTMHYG--------TG
A0A3P8VKM5_MCL1-04      -MNIIKN-NQAKLN--VATGVLGCFIVPQNGVVNGTMHYG--------TG
A0A3P8VKM5_MCL1-05      -MNIIKN-NQAKLN--VATGVLGCFIVPQNGVVNGTMHYG--------TG
A0A3Q3IZW0_MCL1-01      -MNIITS-KKWADV--NVTTEIMSLILPQNGVVEGSMHCG--------S-
A0A3Q1GX28_MCL1-02      --MLPSG-RTAMKL---ATGGMSCLMLPQNGVVE----YS--------SG
A0A3Q1GX28_MCL1-01      --MLPSG-RTAMKL---ATGGMSCLMLPQNGVVE----YS--------SG
A0A3B4XKA5_MCL1-01      -MNLIQA-PKQAAL---T--AVNYCICRQNGGLE-TWRDS--------SG
A0A3Q3GP42_MCL1-01      -MDIINM-KRAAVS---VSAGVMSFMMPQNGVGKGQMHYG--------PE
A0A3Q3M6G2_MCL1-01      -MSFIPS-TRRAAL---IP-GVM-IVLPQDGVLEGPVHYD--------SR
A0A3Q3M6G2_MCL1-02      -MSFIPS-TRRAAL---IP-GVM-IVLPQDGVLEGPVHYD--------SR
A0A3B1IEV7_MCL1-01      ------------------MNPTAISLLCDGTSPVLYRTEK--------EE
A0A3B4CGU9_MCL1-03      ------------------MESAAISLFCNGAGRIPFNKGS--------ES
A0A3B4CGU9_MCL1-02      ------------------ME-------AHGGVQINMAAHP--------GG
A0A3B4AFB7_MCL1-01      ------------------DTTCLQGVLTPPLGTAHICGSP--------HP
Q8UWD6_MCL1-01          -------------M--FAGRNNDNGFWPC-------TGLQ--------SK
A2BF68_MCL1-01          -------------M--FAGRNNDNGFWPC-------TGLQ--------SK
Q568W5_MCL1-01          -------------M--FAGRNNDNGFWPC-------TGLQ--------SK
A0A3B1K5R1_MCL1-01      -----MMSPQDMCS--YNKKTA--DIVPRVAVRGGGGGAG--------LS
A0A3B4C6H5_MCL1-03      -----MMMSPKEMY--FDKKTVFPSLLAKRPFTLGISSQT--------RA
A0A3B4C6H5_MCL1-01      -------LFSFVWE--FSRKWPWNFLWEK---------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------PG
A0A2K5EPX0_MCL1-02      -----SQS-YNNLK--IT--------------------------------
A0A2K5EPX0_MCL1-01      -----NAS-CSRPA--CF--------------------------------
Q9Z1P3_MCL1-01          -----MFG-LRRNA--VIGLNLYC---------GGASLG---------AG
A5PJR2_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------QG
A0A452GA25_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------QG
G1L3L7_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
G1T2Q0_MCL1-01          ---MAMFS-LRRNA--VIGLNLYL---------GGPGLG---------AG
F7AVA6_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A337S3J9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLA---------AG
A0A337S3J9_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLA---------AG
Q7YRZ9_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLA---------AG
F1PAP1_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
Q8HYS5_MCL1-01          -----MFG-LKRNA--VIRTQLYC---------GGAGLG---------AG
M3XZZ5_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A452RHX5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
H0XFB7_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
F7GTF7_MCL1-01          -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5CFH3_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6V5Y3_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6KRW9_MCL1-01      -----MFG-FKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5XSB2_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A0D9RZP5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
I7G687_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5LXU8_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3GJZ3_MCL1-02      -----MFG-LRRNA--VIGLNLYC---------GGAGLG---------AG
H2N5Y9_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2R9BPJ5_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3RTV4_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I2YQH7_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5C7L5_MCL1-01      -----MFG-LQRNA--LIGLNLYC---------EWAGLG---------TG
A0A2K5I9I0_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6GI15_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3GJZ3_MCL1-01      -----MFG-LRRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5CFH3_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5R5E2_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5W0W9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6ECR0_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3LFM0_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6KRW9_MCL1-02      -----MFG-FKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6PPI3_MCL1-02      -----MFG-FKRNA--VIGLNLYC---------GGAGLG---------AG
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----MFG-----FQVVIRLNLYC--------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -----GYN------------------------------------------
B6V6J0_MCL1-01          MMHQSVIAKQRPSTSFLIPCQFYC------------------------SG
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      ------------DL--WINLGISC---------GRADLG-----------
G1QAV8_MCL1-01          -----MFG-PKRNA--FIGLNLHC---------GGAVGGLWRQRSLHLLQ
H9GEA6_MCL1-01          -----MFNKKSMVL--VCGGAPSMAPNTPASPGAGGGVG---------ES
H9GEA6_MCL1-02          -----------------------MAPNTPASPGAGGGVG---------ES
A0A493U0E8_MCL1-01      -----------------------------------GGWG---------TE
A0A1L1RNM6_MCL1-01      -----MFA-VKRNA--VIGFNLYC---------GGGSPG---------LV
A0A1L1RNM6_MCL1-02      -----MFA-VKRNA--VIGFNLYC---------GGGSPG---------LV
G2HFR3_MCL1-01          MDICRLSAAMREFY--IVHLDIY---------------------------
F6ZMX1_MCL1-01          -----MLGPFKKNA--VIGLNLYC---------GGAGMG---------AG
F6ZMX1_MCL1-02          -----MLGPFKKNA--VIGLNLYC---------GGAGMG---------AG
F6ZMX1_MCL1-03          -----MLGPFKKNA--VIGLNLYC---------GGAGMG---------AG
G1T2Q0_MCL1-02          -----MFS-LRRNA--VIGLNLYL---------GGPGLG---------AG
F1PAP1_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A337S3J9_MCL1-04      -----MFG-LKRNA--VIGLNLYC---------GGAGLA---------AG
F7AVA6_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6GI15_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
C8YZ26_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
F7GTF7_MCL1-02          -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5R5E2_MCL1-04      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6V5Y3_MCL1-03      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5LXU8_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5I9I0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I2YQH7_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
Q07820_MCL1-04          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5W0W9_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6ECR0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K5XSB2_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2R9BPJ5_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3RTV4_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2I3LFM0_MCL1-03      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A2K6PPI3_MCL1-03      -----MFG-FKRNA--VIGLNLYC---------GGAGLG---------AG
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          -----MFG-LRRNA--VIGLNLYC---------GGASLG---------AG
A0A452GA25_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------QG
G3T756_MCL1-01          -----MFG-FKRNA--VIGLNLYC---------GGAGLG---------A-
A0A1S3F3I1_MCL1-01      -----MFG-LRRNA--VIGLNFYC---------GGAGLG---------AG
G1L3L7_MCL1-02          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A287BK44_MCL1-02      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------PG
A0A287BK44_MCL1-01      -----MFG-LQRNA--VIGLNLYC---------GGAGLG---------PG
B4DU51_MCL1-01          -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AG
A0A287DCH9_MCL1-02      -----MFG-LKRNA--VIGLNLYC---------G----------------
A0A287DCH9_MCL1-01      -----MFG-LKRNA--VIGLNLYC---------GGAGLG---------AS
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          -------VEDELDGYIE--------EEEAP--------------------
Q1L8X3_MCL1-01          -------VEDELDGYIE--------EEEAP--------------------
Q9I9N3_MCL1-01          -------VEDELDGYTE--------EEEAP--------------------
W5MMB7_MCL1-01          CPGGSAARTAVLDPMLKADYAEDELDNYSA--------------------
A0A3B3R4U0_MCL1-01      ASLPVAPLKAKSEEELDSLD-----EGERF--------------------
A0A3B3SG34_MCL1-01      ANTPCLESSGLWDDELDNCTD----EVDVC--------------------
A0A3Q2Y539_MCL1-01      -------------------------LQEVE--------------------
Q4SW32_MCL1-01          LSSSQIPMGSPRDAFNGN-------VGDSP--------------------
Q0KFR9_MCL1-01          AICAGASPKSK--VDLGNG------TGDTP--------------------
A0A3P8Y1W8_MCL1-02      PLCPAASSKSKMDVDLGNG------TADTP--------------------
A0A3P8Y1W8_MCL1-01      PLCPAASSKSKMDVDLGNG------TADTP--------------------
D2ITA0_MCL1-03          GSHTTTEGALPLMATFKS-------GDERK--------------------
D2ITA0_MCL1-04          GSHTTTEGALPLMATFKS-------GDERK--------------------
A0A3P9ILF6_MCL1-02      EMSARVPLPSTLASRVANPD-----PSDQF--------------------
A0A3P9ILF6_MCL1-01      EMSARVPLPSTLASRVANPD-----PSDQF--------------------
A0A3Q2XZL8_MCL1-01      PVAAASTSPPQLHRAVATLGAVNCNSGAAK--------------------
A0A3B4AFB7_MCL1-02      DSSAQMPRPATMDTRKGNTA-----SSGSP--------------------
A0A3B3VM25_MCL1-01      LVVPEVAMGATVDSLHSP-------KDPYK--------------------
I3KXG5_MCL1-01          NDVGFIDNWETLCRKPGLVR-----RDGIH--------------------
A0A3Q0R633_MCL1-01      ---------TSPDS------------NGTP--------------------
A0A3Q0R633_MCL1-03      NSSPQDATGTPKDS------------NGTP--------------------
A0A3B4T8L9_MCL1-02      DSSPEIAIGSTICSHNGNVV-----PNDNS--------------------
A0A3B4T8L9_MCL1-01      DSSPEIAIGSTICSHNGNVV-----PNDNS--------------------
A0A3Q1EQB9_MCL1-02      DSSPQISVASSIDPQNGNLG-----SSDTP--------------------
A0A3B4ZKP6_MCL1-01      DPSAQIPMASPLDSHNGNVG-----SGATP--------------------
A0A3Q1BKL8_MCL1-02      DSSPQIAVASSIDSHNGNVG-----SNETP--------------------
A0A3Q1EQB9_MCL1-01      DSSPQISVASSIDPQNGNLG-----SSDTP--------------------
A0A3Q1BKL8_MCL1-01      DSSPQIAVASSIDSHNGNVG-----SNETP--------------------
A0A3P8RQX7_MCL1-02      DSSPQIAVASSIDSHNGNVG-----SSETP--------------------
A0A3P8RQX7_MCL1-01      DSSPQIAVASSIDSHNGNVG-----SSETP--------------------
G3PJT0_MCL1-01          --MRQLAMGSAKDSHNGNAGT-----NDTP--------------------
A0A3B3IJ04_MCL1-01      EMSARVPLPSTLASHVANPDP-----SDQL--------------------
A0A3P9L1F3_MCL1-01      EMSARVPLPSTLASRVANPDP-----SDQL--------------------
A0A3B3IJ04_MCL1-02      EMSARVPLPSTLASHVANPDP-----SDQL--------------------
A0A3P9L1F3_MCL1-02      EMSARVPLPSTLASRVANPDP-----SDQL--------------------
A0A3B3CEX1_MCL1-01      ERSARVPLTSATASRGANPDP-----SEQM--------------------
A0A3B3CEX1_MCL1-02      ERSARVPLTSATASRGANPDP-----SEQM--------------------
A0A3Q3VP02_MCL1-01      --SSQIGMGSCLDSHNGNVAL-----NDTS--------------------
A0A3Q3B4P5_MCL1-01      DTSPQVSIGASLGSENGSVAS-----CNSS--------------------
A0A3Q3B4P5_MCL1-02      DTSPQVSIGASLGSENGSVAS-----CNSS--------------------
A0A3Q2EDX8_MCL1-01      IAAPEIPMNSPMGSLHRN----------LM--------------------
A0A3Q2P7X9_MCL1-01      LQLPEVEMSSSSEDLRWDC-------S-----------------------
A0A3Q2P7X9_MCL1-02      LQLPEVEMSSSSEDLRWDC-------S-----------------------
A0A3B5PQ55_MCL1-01      LGVPEVAMGSTVESLHSPK-------DPFM--------------------
A0A3B5PQ55_MCL1-02      LGVPEVAMGSTVESLHSPK-------DPFM--------------------
A0A3P9Q4I8_MCL1-01      LVVPEVAMGSRVESLHSPM-------DPFK--------------------
A0A3P9Q4I8_MCL1-02      LVVPEVAMGSRVESLHSPM-------DPFK--------------------
A0A087X830_MCL1-01      LVVPEVAMGATVDSLHSPK-------DPYK--------------------
A0A3B3YCD0_MCL1-01      LVVPEVAMGATVDSLHSPK-------DPYK--------------------
I3JHR5_MCL1-02          KSSPQNATGSSKDSSNGIVS------NGTP--------------------
I3JHR5_MCL1-03          KSSPQNATGSSKDSSNGIVS------NGTP--------------------
I3JHR5_MCL1-01          KSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3Q4HLQ8_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3P8NP63_MCL1-02      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3Q2VNL8_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3P8NP63_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3P9BVM3_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A3B4G4Z6_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGTP--------------------
A0A2U9CJ81_MCL1-01      NSLPQIAVGSVIDSRGGNVGA-----GDAP--------------------
A0A3P8VKM5_MCL1-03      NSTP-IALASSLSTHNDSMSS----VTETQ--------------------
A0A3P8VKM5_MCL1-04      NSTP-IALASSLSTHNDSMSS----VTETQ--------------------
A0A3P8VKM5_MCL1-05      NSTP-IALASSLSTHNDSMSS----VTETQ--------------------
A0A3Q3IZW0_MCL1-01      NTSPQFAVGSSIDSCKGNVGP-----NNTL--------------------
A0A3Q1GX28_MCL1-02      VNSPQITMSSSIDACNGN---------AAL--------------------
A0A3Q1GX28_MCL1-01      VNSPQITMSSSIDACNGN---------AAL--------------------
A0A3B4XKA5_MCL1-01      DSSPEIAIGSTLCCDNGNVVP-----NDNS--------------------
A0A3Q3GP42_MCL1-01      ASSPQIAMGSSLASQNGNVGS-----NETT--------------------
A0A3Q3M6G2_MCL1-01      DPSTQF----TLDSRNGN-GG-----TANP--------------------
A0A3Q3M6G2_MCL1-02      DPSTQF----TLDSRNGN-GG-----TANP--------------------
A0A3B1IEV7_MCL1-01      KLPRTERPERGLEG-----------LQSAK--------------------
A0A3B4CGU9_MCL1-03      QLDRPDRPDRGLEG-----------LQAAP--------------------
A0A3B4CGU9_MCL1-02      SICAPVLHGSSFGGPVTLIYL----IHGGQ--------------------
A0A3B4AFB7_MCL1-01      RPTALVMKNE---------------LLNKN--------------------
Q8UWD6_MCL1-01          PLVIPELKA-----------------------------------------
A2BF68_MCL1-01          PLVIPELKA-----------------------------------------
Q568W5_MCL1-01          PLVIPELKA-----------------------------------------
A0A3B1K5R1_MCL1-01      LGLAADIRP-----------------------------------------
A0A3B4C6H5_MCL1-03      PRIAA---------------------------------------------
A0A3B4C6H5_MCL1-01      -LIAA---------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -------MGGSL--------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          SG------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --GGSP-AGTRLAA--EEAKARRE-GGGEA--------------------
A5PJR2_MCL1-01          S-GASS-PGGRLLAAGKEATARREVGGGEAGTVIGGSAG---------PS
A0A452GA25_MCL1-01      S-GASS-PGGRLLAAGKEATARREVGGGEAGTVIGGSAG---------PS
G1L3L7_MCL1-01          SGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG---------AS
G1T2Q0_MCL1-01          GGGVAP-PAERLLAAEKEAAARLEVGGGEAGAVIGGSPG---------AS
F7AVA6_MCL1-01          GGGASS-PGGRLLAAGKEATARREGGGGEAGAVIGGSAG---------GS
A0A337S3J9_MCL1-01      SGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------AS
A0A337S3J9_MCL1-03      SGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------AS
Q7YRZ9_MCL1-01          SGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------AS
F1PAP1_MCL1-01          SGGASS-SGGRLLASGKEATTRREGGGGEAGAVIGGSAG---------AS
Q8HYS5_MCL1-01          SGGASS-SGGRLLASGREATTRREGGGGEAGAVIGGSAG---------AS
M3XZZ5_MCL1-01          TGGASS-SGGRLLASGKEATARREVGGGEAGAVIGGSAG---------AS
A0A452RHX5_MCL1-01      SGGAAS-SGGRLLASGKEATARREVGGGEAGAVIGGSAG---------AS
H0XFB7_MCL1-01          SGGATP-PGGRLLAAEKEAAARREAGGGEAGEVIGGSPG---------AS
F7GTF7_MCL1-01          SGGATP-PGGRLLATEKEASAQREVGGGEAGAVTGGSAG---------AS
A0A2K5CFH3_MCL1-01      SGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSAG---------AS
A0A2K6V5Y3_MCL1-01      SGGATP-PGGRLLAAEKEASAQREVGGGEAGAVIGGSAG---------AS
A0A2K6KRW9_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------AS
A0A2K5XSB2_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A0D9RZP5_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
I7G687_MCL1-01          SSGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A2K5LXU8_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A2I3GJZ3_MCL1-02      SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
H2N5Y9_MCL1-01          SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
A0A2R9BPJ5_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
A0A2I3RTV4_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
A0A2I2YQH7_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
A0A2K5C7L5_MCL1-01      SGGTTP-PGGRLLATEKEASAQREVGGGEAGVVIGGSAG---------AS
A0A2K5I9I0_MCL1-02      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A2K6GI15_MCL1-01      SSGATP-PGGRLLAAEKEATARREVGGGEDGTVIGGSPG---------AS
A0A2I3GJZ3_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------AS
A0A2K5CFH3_MCL1-03      SGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSAG---------AS
A0A2K5R5E2_MCL1-03      SGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSVG---------AS
A0A2K5W0W9_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A2K6ECR0_MCL1-02      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------AS
A0A2I3LFM0_MCL1-01      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGTAG---------AS
A0A2K6KRW9_MCL1-02      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------AS
A0A2K6PPI3_MCL1-02      SGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------AS
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      ---GAIPPGPRLL-------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
B6V6J0_MCL1-01          GGSSEKTLSARGA-------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          EGGPCPQESG------------------------AGRETGTVIGWSAGAS
H9GEA6_MCL1-01          SGGNNNDGGGVSV-----------------------------------PK
H9GEA6_MCL1-02          SGGNNNDGGGVSV-----------------------------------PK
A0A493U0E8_MCL1-01      SWRNTSWPSKGPARSDHLGSV---------------LWKSEASSQGPARI
A0A1L1RNM6_MCL1-01      PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAP---
A0A1L1RNM6_MCL1-02      PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAP---
G2HFR3_MCL1-01          ---PPPECTIHML-------------------------------------
F6ZMX1_MCL1-01          GGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRAS
F6ZMX1_MCL1-02          GGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRAS
F6ZMX1_MCL1-03          GGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRAS
G1T2Q0_MCL1-02          GGGVAP-PAERLL-------------------------------------
F1PAP1_MCL1-02          SGGASS-SGGRLL-------------------------------------
A0A337S3J9_MCL1-04      SGGASS-SGGRLV-------------------------------------
F7AVA6_MCL1-02          GGGASS-PGGRLL-------------------------------------
A0A2K6GI15_MCL1-03      SSGATP-PGGRLL-------------------------------------
C8YZ26_MCL1-01          SGGATR-PGGRLL-------------------------------------
F7GTF7_MCL1-02          SGGATP-PGGRLL-------------------------------------
A0A2K5R5E2_MCL1-04      SGGATP-PGGRLL-------------------------------------
A0A2K6V5Y3_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2K5LXU8_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2K5I9I0_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2I2YQH7_MCL1-03      SGGATP-PGGRLL-------------------------------------
Q07820_MCL1-04          SGGATR-PGGRLL-------------------------------------
A0A2K5W0W9_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2K6ECR0_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2K5XSB2_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2R9BPJ5_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2I3RTV4_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2I3LFM0_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A2K6PPI3_MCL1-03      SGGATP-PGGRLL-------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          GGSPA---GARLVA--EEAKARREGGGE----------------------
A0A452GA25_MCL1-02      SGASSP--GGRLLAAGKEATAR---------------AG---------PS
G3T756_MCL1-01          -GGCATPPGGRLPAPGKEATARQEVGGGD--------AG---------AS
A0A1S3F3I1_MCL1-01      SGAAAA-PGGRLL-TAEEASARREAGGGEAGAGIGGSAG---------AS
G1L3L7_MCL1-02          SGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG---------AS
A0A287BK44_MCL1-02      SGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG---------AS
A0A287BK44_MCL1-01      SGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG---------AS
B4DU51_MCL1-01          SGG-----------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      GGATPP--GAQLLAAEKEAAARREAGGGE---------------------
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-02          --------------------------------------------------
I3JHR5_MCL1-03          --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
G3TVG9_MCL1-01          ------------------GAQGPSVTATPARPMLFASIPCTSPPEEANAS
J7H260_MCL1-01          -------------------------------------------------P
G1PZ39_MCL1-01          ------------APPSPISGRGPRRHRDPSRGGCLRPLAVRGCPRRWKAA
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          ---ALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMAAS
A5PJR2_MCL1-01          PPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESP
A0A452GA25_MCL1-01      PPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESP
G1L3L7_MCL1-01          PPX---------------GAEGPDVTATPPRLLFLEPTRRASPPEEMEGP
G1T2Q0_MCL1-01          PPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAP
F7AVA6_MCL1-01          PQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFAPTRCASPPEGMEAP
A0A337S3J9_MCL1-01      PPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGP
A0A337S3J9_MCL1-03      PPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGP
Q7YRZ9_MCL1-01          PPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEEMEGP
F1PAP1_MCL1-01          PPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGP
Q8HYS5_MCL1-01          PPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGP
M3XZZ5_MCL1-01          TPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTHRASPPEEMEGP
A0A452RHX5_MCL1-01      PPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGP
H0XFB7_MCL1-01          SPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLRAAPREEMEAP
F7GTF7_MCL1-01          PPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAP
A0A2K5CFH3_MCL1-01      PPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAP
A0A2K6V5Y3_MCL1-01      PPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAP
A0A2K6KRW9_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAP
A0A2K5XSB2_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAP
A0A0D9RZP5_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
I7G687_MCL1-01          PPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAPLEEMEAP
A0A2K5LXU8_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2I3GJZ3_MCL1-02      PPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPLEEMEAP
H2N5Y9_MCL1-01          PPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAP
A0A2R9BPJ5_MCL1-01      PPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2I3RTV4_MCL1-01      PPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2I2YQH7_MCL1-01      PPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2K5C7L5_MCL1-01      PSAALTPDAR----------------GSCGRCWFFAPTRRAAPLEEMEAP
A0A2K5I9I0_MCL1-02      PPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2K6GI15_MCL1-01      PPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRRALPSEEMEAP
A0A2I3GJZ3_MCL1-01      PPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPLEEMEAP
A0A2K5CFH3_MCL1-03      PPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAP
A0A2K5R5E2_MCL1-03      PPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAP
A0A2K5W0W9_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPLEEMEAP
A0A2K6ECR0_MCL1-02      PPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPLEEMEAP
A0A2I3LFM0_MCL1-01      PPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAP
A0A2K6KRW9_MCL1-02      PPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAP
A0A2K6PPI3_MCL1-02      PPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAP
G3WBC5_MCL1-01          ------------------------DVTAPPRPFFFAPGGRCSPPAEVADG
W5QI41_MCL1-01          -----------------------------------------GSRKPRPAP
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          ---------------------------MFGLKRNAVIGLNLYCGGAGLGA
B4DG83_MCL1-01          ----------------------------------------------MEAP
B4E3L8_MCL1-01          ----------------------------------------------MEAP
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          ------------------------------------------LPDQMEAQ
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          PQATLARDPGRVARPSPMGTEGPDGTAAPARWLFSPISRNC--PEELGAL
H9GEA6_MCL1-01          ASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKW
H9GEA6_MCL1-02          ASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKW
A0A493U0E8_MCL1-01      DHFGSVPWNSEASPRGVVGTAHFGSVLWN------------------SEA
A0A1L1RNM6_MCL1-01      ----RAPIGSGAAPHAPIGSAAARRAPPD------------------STS
A0A1L1RNM6_MCL1-02      ----RAPIGSGAAPHAPIGSAAARRAPPD------------------STS
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          PPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVADG
F6ZMX1_MCL1-02          PPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVADG
F6ZMX1_MCL1-03          PPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVADG
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          --AALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAAS
A0A452GA25_MCL1-02      PPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESP
G3T756_MCL1-01          PPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPPVEMEAL
A0A1S3F3I1_MCL1-01      PSTTLAPDARRVARPAPIGAEVPDVTGTPTKRVFFAPTHRAPTPDEMEAA
G1L3L7_MCL1-02          PPAXXX--XXXXXXXXXXGAEGPDVTATPPRLLFLEPTRRASPPEEMEGP
A0A287BK44_MCL1-02      PPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESP
A0A287BK44_MCL1-01      PPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESP
B4DU51_MCL1-01          -------------------------ATRPGGRLL---------ATEMEAP
A0A287DCH9_MCL1-02      ------------------GAEVPDVTATPARRLFFAPTYCVSPPEKMEAP
A0A287DCH9_MCL1-01      --AAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPPEKMEAP
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          -------------------------------------------LKRLRPG
Q1L8X3_MCL1-01          -------------------------------------------LKRLRPG
Q9I9N3_MCL1-01          -------------------------------------------LKRLRPG
W5MMB7_MCL1-01          -------------------------------------------EPVATSA
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      -------------------------------------------PCSTRLA
A0A3Q2Y539_MCL1-01      -------------------------------------------RRSDNSD
Q4SW32_MCL1-01          -------------------------------------------KRPSKLT
Q0KFR9_MCL1-01          -------------------------------------------PRPTTLG
A0A3P8Y1W8_MCL1-02      -------------------------------------------VRPTKLE
A0A3P8Y1W8_MCL1-01      -------------------------------------------VRPTKLE
D2ITA0_MCL1-03          -------------------------------------------PRPTELG
D2ITA0_MCL1-04          -------------------------------------------PRPTELG
A0A3P9ILF6_MCL1-02      -------------------------------------------KRPQDLE
A0A3P9ILF6_MCL1-01      -------------------------------------------KRPQDLE
A0A3Q2XZL8_MCL1-01      -------------------------------------------PRPSALE
A0A3B4AFB7_MCL1-02      --------------------------------------------HPRPTA
A0A3B3VM25_MCL1-01      -------------------------------------------QRPTNLA
I3KXG5_MCL1-01          -------------------------------------------PTLDGAA
A0A3Q0R633_MCL1-01      -------------------------------------------KRPNNLG
A0A3Q0R633_MCL1-03      -------------------------------------------KRPNNLG
A0A3B4T8L9_MCL1-02      -------------------------------------------KRPKSLE
A0A3B4T8L9_MCL1-01      -------------------------------------------KRPKSLE
A0A3Q1EQB9_MCL1-02      -------------------------------------------KRPKNLG
A0A3B4ZKP6_MCL1-01      -------------------------------------------KRPKNLG
A0A3Q1BKL8_MCL1-02      -------------------------------------------KRPKNLG
A0A3Q1EQB9_MCL1-01      -------------------------------------------KRPKNLG
A0A3Q1BKL8_MCL1-01      -------------------------------------------KRPKNLG
A0A3P8RQX7_MCL1-02      -------------------------------------------KRPKNLG
A0A3P8RQX7_MCL1-01      -------------------------------------------KRPKNLG
G3PJT0_MCL1-01          -------------------------------------------KRPSALG
A0A3B3IJ04_MCL1-01      -------------------------------------------KRPQDLE
A0A3P9L1F3_MCL1-01      -------------------------------------------KRPQDLE
A0A3B3IJ04_MCL1-02      -------------------------------------------KRPQDLE
A0A3P9L1F3_MCL1-02      -------------------------------------------KRPQDLE
A0A3B3CEX1_MCL1-01      -------------------------------------------KRPQDLD
A0A3B3CEX1_MCL1-02      -------------------------------------------KRPQDLD
A0A3Q3VP02_MCL1-01      -------------------------------------------KRPNLLV
A0A3Q3B4P5_MCL1-01      -------------------------------------------KRPKDLV
A0A3Q3B4P5_MCL1-02      -------------------------------------------KRPKDLV
A0A3Q2EDX8_MCL1-01      -------------------------------------------KRPKDLQ
A0A3Q2P7X9_MCL1-01      -------------------------------------------KRPKNLR
A0A3Q2P7X9_MCL1-02      -------------------------------------------KRPKNLR
A0A3B5PQ55_MCL1-01      -------------------------------------------KRPTNLG
A0A3B5PQ55_MCL1-02      -------------------------------------------KRPTNLG
A0A3P9Q4I8_MCL1-01      -------------------------------------------KRPTNLA
A0A3P9Q4I8_MCL1-02      -------------------------------------------KRPTNLA
A0A087X830_MCL1-01      -------------------------------------------KRPTNLA
A0A3B3YCD0_MCL1-01      -------------------------------------------QRPTNLA
I3JHR5_MCL1-02          -------------------------------------------KRPNNLG
I3JHR5_MCL1-03          -------------------------------------------KRPNNLG
I3JHR5_MCL1-01          -------------------------------------------KRPNNLG
A0A3Q4HLQ8_MCL1-01      -------------------------------------------KRPDNLE
A0A3P8NP63_MCL1-02      -------------------------------------------KRPDNLE
A0A3Q2VNL8_MCL1-01      -------------------------------------------KRPDNLE
A0A3P8NP63_MCL1-01      -------------------------------------------KRPDNLE
A0A3P9BVM3_MCL1-01      -------------------------------------------KRPDNLE
A0A3B4G4Z6_MCL1-01      -------------------------------------------KRPDNLE
A0A2U9CJ81_MCL1-01      -------------------------------------------KRPKNLQ
A0A3P8VKM5_MCL1-03      -------------------------------------------RRPKDLQ
A0A3P8VKM5_MCL1-04      -------------------------------------------RRPKDLQ
A0A3P8VKM5_MCL1-05      -------------------------------------------RRPKDLQ
A0A3Q3IZW0_MCL1-01      -------------------------------------------KRPKILD
A0A3Q1GX28_MCL1-02      -------------------------------------------KRPKNLD
A0A3Q1GX28_MCL1-01      -------------------------------------------KRPKNLD
A0A3B4XKA5_MCL1-01      -------------------------------------------KRPKSLE
A0A3Q3GP42_MCL1-01      -------------------------------------------KRPKALV
A0A3Q3M6G2_MCL1-01      -------------------------------------------KRPKNLE
A0A3Q3M6G2_MCL1-02      -------------------------------------------KRPKNLE
A0A3B1IEV7_MCL1-01      -------------------------------------------G------
A0A3B4CGU9_MCL1-03      -------------------------------------------GPAS---
A0A3B4CGU9_MCL1-02      -------------------------------------------GGSS---
A0A3B4AFB7_MCL1-01      -------------------------------------------TREE---
Q8UWD6_MCL1-01          -------------------------------------------HNQF---
A2BF68_MCL1-01          -------------------------------------------HNQF---
Q568W5_MCL1-01          -------------------------------------------HNQF---
A0A3B1K5R1_MCL1-01      -------------------------------------------TRPG---
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
G3TVG9_MCL1-01          VAEAIMSAEEELGRYKLETLG----------------------KRPAALP
J7H260_MCL1-01          SPQSELDEDEDYMDVQSDSRG-----------------------------
G1PZ39_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          AA-AIMSPEEELDGCEPEVLS----------------------KRPAVLP
A5PJR2_MCL1-01          ISDAIMSPEEELDGCEPDPLG----------------------KRPAVRP
A0A452GA25_MCL1-01      ISDAIMSPEEELDGCEPDPLG----------------------KRPAVRP
G1L3L7_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
G1T2Q0_MCL1-01          AADAIMSPEEELDGYEPEPLA----------------------KRPAVLP
F7AVA6_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A337S3J9_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A337S3J9_MCL1-03      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
Q7YRZ9_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
F1PAP1_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
Q8HYS5_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
M3XZZ5_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A452RHX5_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
H0XFB7_MCL1-01          AADAIMSPEDELDGYEPEPLG----------------------KRPAVLP
F7GTF7_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5CFH3_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K6V5Y3_MCL1-01      AADAIMSPEDELDGYEPEPLG----------------------KRPAVLP
A0A2K6KRW9_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5XSB2_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A0D9RZP5_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
I7G687_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5LXU8_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2I3GJZ3_MCL1-02      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
H2N5Y9_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2R9BPJ5_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2I3RTV4_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2I2YQH7_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5C7L5_MCL1-01      AADAIMSPEEELDRYEPEPLG----------------------KRPAVLP
A0A2K5I9I0_MCL1-02      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K6GI15_MCL1-01      AADAIMSPEDELDGYEPEPLG----------------------KRPAVLP
A0A2I3GJZ3_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5CFH3_MCL1-03      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5R5E2_MCL1-03      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5W0W9_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K6ECR0_MCL1-02      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2I3LFM0_MCL1-01      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K6KRW9_MCL1-02      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K6PPI3_MCL1-02      AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
G3WBC5_MCL1-01          AADAILSPEDELDGYEPELPG----------------------KRPARLA
W5QI41_MCL1-01          GPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMFGFKRRPAVRP
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          GSGGATRPGGRLLATEKEASA----------------------RRE----
B4DG83_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
B4E3L8_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
B6V6J0_MCL1-01          -----SPWDPDMDTHRPQLNG----------------------LGFNNGG
H0XHA5_MCL1-01          VADAVKSPEGEVASCEPEPLK----------------------KQPEGLP
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          AADAIMSPGEELGRYEPEP------------------------KQPAVLP
H9GEA6_MCL1-01          RPASLPLPEGELDGCEEAEEE----------------------EAATVPS
H9GEA6_MCL1-02          RPASLPLPEGELDGCEEAEEE----------------------EAATVPS
A0A493U0E8_MCL1-01      SPWG-WGGTDHFGAVFPEPSS----------------------G------
A0A1L1RNM6_MCL1-01      RPVALWSPEEELDGCEPESER----------------------G------
A0A1L1RNM6_MCL1-02      RPVALWSPEEELDGCEPESER----------------------G------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          AADVPMCPEEELDGYEPEPPG----------------------KRPSRLA
F6ZMX1_MCL1-02          AADVPMCPEEELDGYEPEPPG----------------------KRPSRLA
F6ZMX1_MCL1-03          AADVPMCPEEELDGYEPEPPG----------------------KRPSRLA
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      -----MSPEEELDGYEPEPLG----------------------KRPAVLP
P97287_MCL1-01          AAAAIVSPEEELDGCEPEAIG----------------------KRPAVLP
A0A452GA25_MCL1-02      ISDAIMSPEEELDGCEPDPLG----------------------KRPAVRP
G3T756_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVFP
A0A1S3F3I1_MCL1-01      AAGAIMSPEEELDGYEPEPLG----------------------KRPAVLP
G1L3L7_MCL1-02          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A287BK44_MCL1-02      ASDAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A287BK44_MCL1-01      ASDAIMSPEEELDGYEPEPLG----------------------KRPAVLP
B4DU51_MCL1-01          AADAIMSPEEELDGYEPEPLG----------------------KRPAVLP
A0A287DCH9_MCL1-02      AAA--MSPEEELDGYEPEPLG----------------------KRPAVLP
A0A287DCH9_MCL1-01      AAA--MSPEEELDGYEPEPLG----------------------KRPAVLP
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          TNGLKG-LQLDGRFVS-----------TTDGSLPTTPDPEELDYA-----
Q1L8X3_MCL1-01          TNGLKG-LQLDGRFVS-----------ATDGSLPTTPDPEELDYA-----
Q9I9N3_MCL1-01          TNGLKG-LQLDGRFVS-----------ATDGSLPTTPDPEELDYA-----
W5MMB7_MCL1-01          WIPKSP-RSLPAGLKL---GGHFPESGHADGSLPSTPDTPLDCGSVPEF-
A0A3B3R4U0_MCL1-01      ----HG-APKTERRDC---EHHLRASGNEDGSLPSTPGTPPDCGKMLTF-
A0A3B3SG34_MCL1-01      KRDSEK-EPCRGSRLP---GST-----NAVGSLPTSPDGDLPAYGPICG-
A0A3Q2Y539_MCL1-01      ---------------------------MDEGAQP-LPELQT---------
Q4SW32_MCL1-01          VVKPKV-CLSKTIQED---SE--------DGSLPCTPESHSGDVLDVSG-
Q0KFR9_MCL1-01          VNVVKS-NGLDNHLSD---RSN-----N-DDSLPCTPQMASECGPELSN-
A0A3P8Y1W8_MCL1-02      VNMTKP-NVLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGLSH-
A0A3P8Y1W8_MCL1-01      VNMTKP-NVLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGLSH-
D2ITA0_MCL1-03          ----RG-RLVNKSQDD---QEG-------NGSLPSTPELQSEVDTD----
D2ITA0_MCL1-04          ----RG-RLVNKSQDD---QEG-------NGSLPSTPELQSEVDTD----
A0A3P9ILF6_MCL1-02      -------YSARRFHDV---DD--------DGSLPNTPEL--ECEASVSG-
A0A3P9ILF6_MCL1-01      -------YSARRFHDV---DD--------DGSLPNTPEL--ECEASVSG-
A0A3Q2XZL8_MCL1-01      ILCKGG-LATMNHRNN---SDDDFDVESSDDSPPSTPDSQDSLVAD----
A0A3B4AFB7_MCL1-02      LVMKNE-LLNKNTREE---DYE-----NSEGSLPCTPEFHSDSEMELSS-
A0A3B3VM25_MCL1-01      VTASNG-YVAKSLQES---SD--------EGSLPCTPA-QQDSETVASA-
I3KXG5_MCL1-01          LISRN----------------------LEDGSLPSTPE------------
A0A3Q0R633_MCL1-01      VVSTNG-YAPKNI------TDD-----VEDGSLPSTPEFHSDSES-----
A0A3Q0R633_MCL1-03      VVSTNG-YAPKNI------TDD-----VEDGSLPSTPEFHSDSES-----
A0A3B4T8L9_MCL1-02      VTSTNG-YATKASRED---SD------VDDGSLPCTPEIQSDGETDVPS-
A0A3B4T8L9_MCL1-01      VTSTNG-YATKASRED---SD------VDDGSLPCTPEIQSDGETDVPS-
A0A3Q1EQB9_MCL1-02      V---NG-YAPKSLRQD---SDS-----MEDGSLPCTPELQSDSETDVSS-
A0A3B4ZKP6_MCL1-01      VSTTNG-FAGKGLRQV---SDS-----LEDSSLPCTPELQSDSETDVSS-
A0A3Q1BKL8_MCL1-02      V---NG-YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDVSS-
A0A3Q1EQB9_MCL1-01      V---NG-YAPKSLRQD---SDS-----MEDGSLPCTPELQSDSETDVSS-
A0A3Q1BKL8_MCL1-01      V---NG-YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDVSS-
A0A3P8RQX7_MCL1-02      V---NG-YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDVSS-
A0A3P8RQX7_MCL1-01      V---NG-YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDVSS-
G3PJT0_MCL1-01          VNSANG-YPSKPQRED---SED-----TDNDSLPCTPESDSE--TDVSD-
A0A3B3IJ04_MCL1-01      -------YSARRF------HDV-----DDDGSLPNTPELECE--ASVSG-
A0A3P9L1F3_MCL1-01      -------YSARRF------HDV-----DDDGSLPNTPELECE--ASVSG-
A0A3B3IJ04_MCL1-02      -------YSARRF------HDV-----DDDGSLPNTPELECE--ASVSG-
A0A3P9L1F3_MCL1-02      -------YSARRF------HDV-----DDDGSLPNTPELECE--ASVSG-
A0A3B3CEX1_MCL1-01      MLGNKSPYAARRF------HD------DDGGSLPNTPELECD--NSVLV-
A0A3B3CEX1_MCL1-02      MLGNKSPYAARRF------HD------DDGGSLPNTPELECD--NSVLV-
A0A3Q3VP02_MCL1-01      VNPTKE-YMGKPIRKDS--TDT-----DDDGSLPYTPDMSPDSELNVSG-
A0A3Q3B4P5_MCL1-01      MPPLKG-YQDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG---
A0A3Q3B4P5_MCL1-02      MPPLKG-YQDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG---
A0A3Q2EDX8_MCL1-01      V-ATNG-YVGKNLSDN---SAD------DGGSLPCTPEMPTDSHPATPG-
A0A3Q2P7X9_MCL1-01      VMARNG-FAVKSIQEN---RDD--------GSLPSTPEMQADSEAAGCG-
A0A3Q2P7X9_MCL1-02      VMARNG-FAVKSIQEN---RDD--------GSLPSTPEMQADSEAAGCG-
A0A3B5PQ55_MCL1-01      V---NG-YVAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDATA-
A0A3B5PQ55_MCL1-02      V---NG-YVAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDATA-
A0A3P9Q4I8_MCL1-01      VTASNG-YVAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDASA-
A0A3P9Q4I8_MCL1-02      VTASNG-YVAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDASA-
A0A087X830_MCL1-01      VSASNG-YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDASA-
A0A3B3YCD0_MCL1-01      VTASNG-YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDASA-
I3JHR5_MCL1-02          VTSTNG-YTTKAI------RDR-----EEDGSLPSTPEYHLD--------
I3JHR5_MCL1-03          VTSTNG-YTTKAI------RDR-----EEDGSLPSTPEYHLD--------
I3JHR5_MCL1-01          VTSTNG-YTTKAI------RDR-----EEDGSLPSTPEYHLD--------
A0A3Q4HLQ8_MCL1-01      VTSTNG-YTTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A3P8NP63_MCL1-02      VTSTNG-YKTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A3Q2VNL8_MCL1-01      VTSTNG-YKTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A3P8NP63_MCL1-01      VTSTNG-YKTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A3P9BVM3_MCL1-01      VTSTNG-YKTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A3B4G4Z6_MCL1-01      VTSTNG-YKTKAI------RDR-----EEDGSLPSTPEFHSD--------
A0A2U9CJ81_MCL1-01      VSATKA-YAAKSCREDGGGGGD-----VGGGSLPSTPESDGE--HDVSG-
A0A3P8VKM5_MCL1-03      VNTANG-HARKSH-------CE-----VDEGSEPCTPEPHSE--AELDV-
A0A3P8VKM5_MCL1-04      VNTANG-HARKSH-------CE-----VDEGSEPCTPEPHSE--AELDV-
A0A3P8VKM5_MCL1-05      VNTANG-HARKSH-------CE-----VDEGSEPCTPEPHSE--AELDV-
A0A3Q3IZW0_MCL1-01      VSSTNG-YGTKTL-VD---VSD-----IDNGSLPCSPVLQPDNEIEVSS-
A0A3Q1GX28_MCL1-02      VSSSNG-YATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDVSS-
A0A3Q1GX28_MCL1-01      VSSSNG-YATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDVSS-
A0A3B4XKA5_MCL1-01      VTSTNG-YATKASRED----SD-----VDDGSLPCTPEMQSDGETDVPS-
A0A3Q3GP42_MCL1-01      VNSGN---------------DD-----IEDGSLPCTPEPDSE--TEVSS-
A0A3Q3M6G2_MCL1-01      VSSTNG-YATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEAPS-
A0A3Q3M6G2_MCL1-02      VSSTNG-YATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEAPS-
A0A3B1IEV7_MCL1-01      --------------------VS-----MGGGSLPDSPL--ADVDFIQDF-
A0A3B4CGU9_MCL1-03      -------------------KAA-----MAGGSLPESPE--SD-DFVPDF-
A0A3B4CGU9_MCL1-02      -------------------SSS-----AQTGS-PAAPE--LT-HVQVNSI
A0A3B4AFB7_MCL1-01      -------------------DYE-----NSEGSLPCTPEFHSDSEMELSS-
Q8UWD6_MCL1-01          -------------------AVD-----SLQGSVPSSPS--DETGDYPP--
A2BF68_MCL1-01          -------------------AVD-----SLQGSVPSSPS--DETGDYPP--
Q568W5_MCL1-01          -------------------AVD-----SLQGSVPSSPS--DETGDYPP--
A0A3B1K5R1_MCL1-01      -------------------VDD--------GSVPSSPL--SDCGEMAVG-
A0A3B4C6H5_MCL1-03      -------------------VTD--------GSLPTSPA--SDCEELDSD-
A0A3B4C6H5_MCL1-01      -------------------VTD--------GSLPTSPA--SDCEELDSD-
A0A3P8V8T6_MCL1-01      -LDMVLISSVC----------------------------------LTLC-
H3AR18_MCL1-01          ------------------------------MELPGDGCPQD----GDMA-
G3TVG9_MCL1-01          LLVLVGEASNC-P--------------GTHGALPSTQPPAE----EEED-
J7H260_MCL1-01          -----------------------------STSPPLTPTCSP-------D-
G1PZ39_MCL1-01          LVQLVGEASGG-P--------------GAGGSLPSTPPPAE----EEED-
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          LLERVSEAAKS-S--------------GADGSLPSTPPPPE----EEDD-
A5PJR2_MCL1-01          LPLLVGEASNNSP--------------GSDGSLPSTPPPAE----EEED-
A0A452GA25_MCL1-01      LALMVGEASNNSP--------------GSDGSLPSTPPPSE----EEED-
G1L3L7_MCL1-01          LLELVGEASGG-P--------------CTDGSLPSTPPPAE----EEED-
G1T2Q0_MCL1-01          LLDLVGEASKV-P--------------STDGSLPSTPPPAE----EEED-
F7AVA6_MCL1-01          LLEFVREASSG-P--------------CTDGSLPSTPPPAE----EEED-
A0A337S3J9_MCL1-01      LLELVGEASSG-P--------------GTDGSLPSTPPPAE----EEED-
A0A337S3J9_MCL1-03      LLELVGEASSG-P--------------GTDGSLPSTPPPAE----EEED-
Q7YRZ9_MCL1-01          LLELVGEASSG-P--------------GTDGSLPSTPPPAE----EEED-
F1PAP1_MCL1-01          LLELVGEASSG-P--------------GMDGSLPSTPPPAE----EEED-
Q8HYS5_MCL1-01          LLELVGEASSG-P--------------GMDGSLPSTPPPAE----EEED-
M3XZZ5_MCL1-01          LLELVGEASSG-P--------------CTDGSLPSTPPPAE----EEED-
A0A452RHX5_MCL1-01      LLELVGEASGG-P--------------CTDGSLPSTPPPAE----EEED-
H0XFB7_MCL1-01          LLELVGEASNG-P--------------STDGSLPSTPPPAE----EEED-
F7GTF7_MCL1-01          LLELVGEPANG-S--------------STDGSLPSTPPPAE----EEED-
A0A2K5CFH3_MCL1-01      LLELVGEPGNG-S--------------STDGSLPSTPPPAE----EEED-
A0A2K6V5Y3_MCL1-01      LLELVGEPGHG-S--------------STDGSLPSTPPPAE----EEED-
A0A2K6KRW9_MCL1-01      LLELVGESGNS-S--------------STDGSLPSTPPPAE----EEED-
A0A2K5XSB2_MCL1-01      LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A0D9RZP5_MCL1-01      LLELVGESGNS-S--------------STDGSLPSTPPPAE----EEED-
I7G687_MCL1-01          LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A2K5LXU8_MCL1-01      LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A2I3GJZ3_MCL1-02      LLELVGESGNN-T--------------STDGSLPSTPPPAE----EEED-
H2N5Y9_MCL1-01          LLELVGESGNN-T--------------STDGSLPSTPPPAE----EEED-
A0A2R9BPJ5_MCL1-01      LLELVGESGNN-T--------------STDGSLPSTPPPAE----EEED-
A0A2I3RTV4_MCL1-01      LLELVGESGNN-T--------------STDGSLPSTPPPAE----EEED-
A0A2I2YQH7_MCL1-01      LLELVGESGND-T--------------STDGSLPSTPPPAE----EEED-
A0A2K5C7L5_MCL1-01      LLELVEEPGND-S--------------STDGSLPSTPP------------
A0A2K5I9I0_MCL1-02      LLELVGES-NS-S--------------STDGSLPSTPPPAE----EEED-
A0A2K6GI15_MCL1-01      LLELVGEASNG-S--------------STDGSLPSTPPPAE----EEDD-
A0A2I3GJZ3_MCL1-01      LLELVGESGNN-T--------------STDGSLPSTPPPAE----EEED-
A0A2K5CFH3_MCL1-03      LLELVGEPGNG-S--------------STDGSLPSTPPPAE----EEED-
A0A2K5R5E2_MCL1-03      LLELVGEPGNG-S--------------STDGSLPSTPPPAE----EEED-
A0A2K5W0W9_MCL1-01      LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A2K6ECR0_MCL1-02      LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A2I3LFM0_MCL1-01      LLELVGESGNS-P--------------STDGSLPSTPPPAE----EEED-
A0A2K6KRW9_MCL1-02      LLELVGESGNS-S--------------STDGSLPSTPPPAE----EEED-
A0A2K6PPI3_MCL1-02      LLELVGESGNS-S--------------STDGSLPSTPPPAE----EEED-
G3WBC5_MCL1-01          MLPLAREGGDTSS--------------NARGSLPSTPPPAEEDEDEEED-
W5QI41_MCL1-01          LPLMVGEASNNSP--------------GSDGSLPSTPPPSE----EEED-
F1MQX4_MCL1-01          ---------------------------------GMLPIFSE----EEED-
B4DLY8_MCL1-01          ----IGGGEAGAV---------------IGGSAGASPPSTL----TPDS-
B4DG83_MCL1-01          LLELVGESGNNTS---------------TDGSLPSTPPPAE----EEED-
B4E3L8_MCL1-01          LLELVGESGNNTS---------------TDGSLPSTPPPAE----EEED-
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          ----------------------------ADGSVPPSPPTPSTP--EDGD-
B6V6J0_MCL1-01          SLPCSQEDELDED--------------MDNGSQGSTSPPDSPV--CPKD-
H0XHA5_MCL1-01          LLEFVGEA--GNG--------------PSTDTLPSTPPPAEEE--DE---
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          LLQLVGEA--SEG--------------PAGGSLPSTPPPAEEE--EEL--
H9GEA6_MCL1-01          STPSPDKEMAEEE--------------GEKGKGGPPLFPDH---------
H9GEA6_MCL1-02          STPSPDKEMAEEE--------------GEKGKGGPPLFPDH---------
A0A493U0E8_MCL1-01      ----------IFS--------------RPARTNPLGSAP-----------
A0A1L1RNM6_MCL1-01      ----------------------------PGGDSLPGTPPELPD--LIPD-
A0A1L1RNM6_MCL1-02      ----------------------------PGGDSLPGTPPELPD--LIPD-
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          VLEIARE---GGD--------------SPNGSLPSTPPPAEED--EEED-
F6ZMX1_MCL1-02          VLEIARE---GGD--------------SPNGSLPSTPPPAEED--EEED-
F6ZMX1_MCL1-03          VLEIARE---GGD--------------SPNGSLPSTPPPAEED--EEED-
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      LLGLVGEAG-KSP--------------SADGSLPSTPPPAEEE--EEED-
P97287_MCL1-01          LLERVSEAA-KSS--------------GADGSLPSTPPPPEEE--EDD--
A0A452GA25_MCL1-02      LALMVGEASNNSP--------------GSDGSLPSTPPPSEEE--EDE--
G3T756_MCL1-01          RLGLVGEAS-NGP--------------GTDGSLPSTPPLAEEE--EDE--
A0A1S3F3I1_MCL1-01      LLELVGEAS-KSS--------------RTDGSLPSTPPPAEEE--DDE--
G1L3L7_MCL1-02          LLELVGEAS-GGP--------------CTDGSLPSTPPPAEEE--EDE--
A0A287BK44_MCL1-02      LLGLVEEAS-SGP--------------GTDGSLPSTPPPAEEE--EDE--
A0A287BK44_MCL1-01      LLGLVEEAS-SGP--------------GTDGSLPSTPPPAEEE--EDE--
B4DU51_MCL1-01          LLELVGESG-NNT--------------STDGSLPLTPPPAEEE--EDE--
A0A287DCH9_MCL1-02      LLELVGEAA-KSP--------------GADGSLPSTPPPAEEE--DDE--
A0A287DCH9_MCL1-01      LLELVGEAA-KSP--------------GADGSLPSTPPPAEEE--DDE--
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          -------------------------------ELERDTRQLLLDFYR---T
Q1L8X3_MCL1-01          -------------------------------ELERDTRQLLLDFYR---T
Q9I9N3_MCL1-01          -------------------------------ELERDTRQLLLDFYR---T
W5MMB7_MCL1-01          ------------------------LSEAHG-QLNAETRELIGTFLQ---M
A0A3B3R4U0_MCL1-01      ------------------------PNRG----LSQETHELIGTFLR---T
A0A3B3SG34_MCL1-01      ------------------------FSRSAVEMLDQETSELITTFFA---E
A0A3Q2Y539_MCL1-01      -------------------------PPGQG-VLDTETRRLIGRFLR---D
Q4SW32_MCL1-01          ------------------------RPAGDEAALDSDTRQLVSRLMA---D
Q0KFR9_MCL1-01          ------------------------CPSGDE-VLEHDTRQLIENFLG---D
A0A3P8Y1W8_MCL1-02      ------------------------CPSGNE-VLDNDTRQLIENLLR---D
A0A3P8Y1W8_MCL1-01      ------------------------CPSGNE-VLDNDTRQLIENLLR---D
D2ITA0_MCL1-03          ------------------------SQAGEE-VLDNDTKRIIRIFLR---D
D2ITA0_MCL1-04          ------------------------SQAGEE-VLDNDTKRIIRIFLR---D
A0A3P9ILF6_MCL1-02      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3P9ILF6_MCL1-01      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3Q2XZL8_MCL1-01      --------------------------GRND-VVDAETKGLIRRFLT---D
A0A3B4AFB7_MCL1-02      ------------------------YSAEHE-VLESDTRQLLSDFFK---L
A0A3B3VM25_MCL1-01      ------------------------VRASNQ-VLDNDTMELIGSFLR---N
I3KXG5_MCL1-01          -----------------------------------ETKLIIHSFLG---D
A0A3Q0R633_MCL1-01      ----------------------------DE-ALERETKSLITSFFR---D
A0A3Q0R633_MCL1-03      ----------------------------DE-ALERETKSLITSFFR---D
A0A3B4T8L9_MCL1-02      ------------------------CPAGDE-VLEDDTRQLISQSMK---S
A0A3B4T8L9_MCL1-01      ------------------------CPAGDE-VLEDDTRQLISQSMK---S
A0A3Q1EQB9_MCL1-02      ------------------------CPTGDE-LLENDTRQLIRRFLR---D
A0A3B4ZKP6_MCL1-01      ------------------------CPAGDE-VLENDTRQLISSFLK---D
A0A3Q1BKL8_MCL1-02      ------------------------CPAGDE-LLENDTRQLLRRFLR---D
A0A3Q1EQB9_MCL1-01      ------------------------CPTGDE-LLENDTRQLIRRFLR---D
A0A3Q1BKL8_MCL1-01      ------------------------CPAGDE-LLENDTRQLLRRFLR---D
A0A3P8RQX7_MCL1-02      ------------------------CPAGDE-LLENDTRQLLRRFLR---D
A0A3P8RQX7_MCL1-01      ------------------------CPAGDE-LLENDTRQLLRRFLR---D
G3PJT0_MCL1-01          ------------------------SPAGAA-ALESDTRQLLGRFLR---E
A0A3B3IJ04_MCL1-01      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3P9L1F3_MCL1-01      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3B3IJ04_MCL1-02      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3P9L1F3_MCL1-02      ------------------------DNSGID-ALNEDTTEFLTNFFR---N
A0A3B3CEX1_MCL1-01      ------------------------PND--P-PINQDTTEFLTNFFR---N
A0A3B3CEX1_MCL1-02      ------------------------PND--P-PINQDTTEFLTNFFR---N
A0A3Q3VP02_MCL1-01      ------------------------CLAGDE-LLEKDTRQLISRVLM---E
A0A3Q3B4P5_MCL1-01      -------------------------GAEDE-VLENDTKHLISRFLQ---E
A0A3Q3B4P5_MCL1-02      -------------------------GAEDE-VLENDTKHLISRFLQ---E
A0A3Q2EDX8_MCL1-01      ------------------------GHAGDE-ALDNDTKELISSFLR---D
A0A3Q2P7X9_MCL1-01      ------------------------SHAGQE-ALDSDTTELISGFLR---D
A0A3Q2P7X9_MCL1-02      ------------------------SHAGQE-ALDSDTTELISGFLR---D
A0A3B5PQ55_MCL1-01      ------------------------VGASNQ-VLDNDTTELISSFLR---D
A0A3B5PQ55_MCL1-02      ------------------------VGASNQ-VLDNDTTELISSFLR---D
A0A3P9Q4I8_MCL1-01      ------------------------VRASNQ-VLDNDTTELISSFLR---N
A0A3P9Q4I8_MCL1-02      ------------------------VRASNQ-VLDNDTTELISSFLR---N
A0A087X830_MCL1-01      ------------------------VRASNQ-VLDNDTMELISSFLR---N
A0A3B3YCD0_MCL1-01      ------------------------VRASNQ-VLDNDTMELISSFLR---H
I3JHR5_MCL1-02          -------------------------GESDE-ELERETKLLIHSFLG---D
I3JHR5_MCL1-03          -------------------------GESDE-ELERETKLLIHSFLG---D
I3JHR5_MCL1-01          -------------------------GESDE-ELERETKLLIHSFLG---D
A0A3Q4HLQ8_MCL1-01      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A3P8NP63_MCL1-02      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A3Q2VNL8_MCL1-01      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A3P8NP63_MCL1-01      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A3P9BVM3_MCL1-01      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A3B4G4Z6_MCL1-01      -------------------------SESDE-QLERETKLLIHSFLG---D
A0A2U9CJ81_MCL1-01      ------------------------CPAADE-ALDSFTRELISQFLR---D
A0A3P8VKM5_MCL1-03      ------------------------SQAGDE-VLDTDTKELIFQFYR---D
A0A3P8VKM5_MCL1-04      ------------------------SQAGDE-VLDTDTKELIFQFYR---D
A0A3P8VKM5_MCL1-05      ------------------------SQAGDE-VLDTDTKELIFQFYR---D
A0A3Q3IZW0_MCL1-01      ------------------------SPAEYE-VLENDTRLLICHFLR---D
A0A3Q1GX28_MCL1-02      ------------------------CPAGDE-VLENDTRQLLSQFLQ---D
A0A3Q1GX28_MCL1-01      ------------------------CPAGDE-VLENDTRQLLSQFLQ---D
A0A3B4XKA5_MCL1-01      ------------------------CPAG-E-VLESDTSQLISQSMK---S
A0A3Q3GP42_MCL1-01      ------------------------CPTGGE-VLESDTRQLISAFLR---E
A0A3Q3M6G2_MCL1-01      ------------------------CPAGDE-VLENDTRQLICQYLK---D
A0A3Q3M6G2_MCL1-02      ------------------------CPAGDE-VLENDTRQLICQYLK---D
A0A3B1IEV7_MCL1-01      ------------------------SCRCPG-ALEAETRRLMVEFYR---G
A0A3B4CGU9_MCL1-03      ---------------------------GGS-ALVEETRRLIGGFYR---G
A0A3B4CGU9_MCL1-02      SISSTKEQTTISLCDGEVTVLIKPKPKGRV-RLEEETLCIIGDFYQ---G
A0A3B4AFB7_MCL1-01      ------------------------YSAEHE-VLESDTRQLLSDFFK---L
Q8UWD6_MCL1-01          -----------------------------T-ALDMDTREIIDTFLK---I
A2BF68_MCL1-01          -----------------------------T-ALDMDTREIIDTFLK---I
Q568W5_MCL1-01          -----------------------------T-ALDMDTREIIDTFLI---I
A0A3B1K5R1_MCL1-01      ------------------------NCKQYE-TLDGDTREIISDFLR---N
A0A3B4C6H5_MCL1-03      ------------------------QFKESE-TLDRDTSEIVIDFLQ---N
A0A3B4C6H5_MCL1-01      ------------------------QFKESE-TLDRDTSEIVIDFLQ---N
A0A3P8V8T6_MCL1-01      -------------------------------TLENDTRQLICDFLK---D
H3AR18_MCL1-01          -------------------------------EFRKETLKLLRSYLC---E
G3TVG9_MCL1-01          -------------------------------KLYPQSLDIIFRYLH---E
J7H260_MCL1-01          -------------------------------PLHTETRALLHTFFR---E
G1PZ39_MCL1-01          -------------------------------ELFRQSLEIISRY-R---E
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          -------------------------------ELYHQSLEIISRYLR---E
A5PJR2_MCL1-01          -------------------------------ELYRQSLEIISQYLR---E
A0A452GA25_MCL1-01      -------------------------------ELYRQSLEIISQYLL---E
G1L3L7_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
G1T2Q0_MCL1-01          -------------------------------ELYRQSLEIIARYLR---E
F7AVA6_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A337S3J9_MCL1-01      -------------------------------ELFRQSLEIISRYLR---E
A0A337S3J9_MCL1-03      -------------------------------ELFRQSLEIISRYLR---E
Q7YRZ9_MCL1-01          -------------------------------ELFRQSLEIISRYLR---E
F1PAP1_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
Q8HYS5_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
M3XZZ5_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A452RHX5_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
H0XFB7_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
F7GTF7_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A2K5CFH3_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K6V5Y3_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K6KRW9_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K5XSB2_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A0D9RZP5_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
I7G687_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A2K5LXU8_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2I3GJZ3_MCL1-02      -------------------------------ELYRQSLEIISRYLR---E
H2N5Y9_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A2R9BPJ5_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2I3RTV4_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2I2YQH7_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K5C7L5_MCL1-01      -----------------------------------TSLEIISRYLR---E
A0A2K5I9I0_MCL1-02      -------------------------------ELYRQSLEIISRYLR---E
A0A2K6GI15_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2I3GJZ3_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K5CFH3_MCL1-03      -------------------------------ELYRQSLEIISRYLR---E
A0A2K5R5E2_MCL1-03      -------------------------------ELYRQSLEIISRYLR---E
A0A2K5W0W9_MCL1-01      -------------------------------ELYRQSLEIISRYLR---E
A0A2K6ECR0_MCL1-02      -------------------------------ELYRQSLEIISRYLR---E
A0A2I3LFM0_MCL1-01      -------------------------------ELYRQSLEIISWYLR---E
A0A2K6KRW9_MCL1-02      -------------------------------ELYRQSLEIISRYLR---E
A0A2K6PPI3_MCL1-02      -------------------------------ELYRQSLEIISRYLR---E
G3WBC5_MCL1-01          -------------------------------ELYGQSLELITRYLR---E
W5QI41_MCL1-01          -------------------------------ELYRQSLEIISQYLL---E
F1MQX4_MCL1-01          -------------------------------ELYWQSLEIISRYLR---E
B4DLY8_MCL1-01          -------------------------------R-------------R---V
B4DG83_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
B4E3L8_MCL1-01          -------------------------------ELYRQSLEIISRYLR---E
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -------------------------------GDMAEFRKETLKLLRSYLC
B6V6J0_MCL1-01          -------------------------------GLYMDTQQLILAFYRVYSG
H0XHA5_MCL1-01          --------------------------------LYWQSMEIISRYLW---E
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          -----------------------------------SLLEMIPQHLR---E
H9GEA6_MCL1-01          --------------------------------LRKTTLEVVGRYLR---E
H9GEA6_MCL1-02          --------------------------------LRKTTLEVVGRYLR---E
A0A493U0E8_MCL1-01      -------------------------------RGRGGDLTILGWFHP---T
A0A1L1RNM6_MCL1-01      -------------------------------ELRQESLELILRYLR---E
A0A1L1RNM6_MCL1-02      -------------------------------ELRQESLELILRYLR---E
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          -------------------------------ELYGQSLELISRYLR---E
F6ZMX1_MCL1-02          -------------------------------ELYGQSLELISRYLR---E
F6ZMX1_MCL1-03          -------------------------------ELYGQSLELISRYLR---E
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      -------------------------------ALYRQSLEIISRYLR---E
P97287_MCL1-01          --------------------------------LYRQSLEIISRYLR---E
A0A452GA25_MCL1-02      --------------------------------LYRQSLEIISQYLL---E
G3T756_MCL1-01          --------------------------------LYRQSLEIISRYLQ---E
A0A1S3F3I1_MCL1-01      --------------------------------LYRQSLEIICRYLR---E
G1L3L7_MCL1-02          --------------------------------LYRQSLEIISRYLR---E
A0A287BK44_MCL1-02      --------------------------------LYRQSLEIISRYLR---E
A0A287BK44_MCL1-01      --------------------------------LYRQSLEIISRYLR---E
B4DU51_MCL1-01          --------------------------------LYRQSLEIISRYLR---E
A0A287DCH9_MCL1-02      --------------------------------LYRQSLEIISRYLR---E
A0A287DCH9_MCL1-01      --------------------------------LYRQSLEIISRYLR---E
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          HTGMCPVD------------------------------------------
Q1L8X3_MCL1-01          HTGMCPVD------------------------------------------
Q9I9N3_MCL1-01          HTGMCPVD------------------------------------------
W5MMB7_MCL1-01          YTGLPHRR------------------------------------------
A0A3B3R4U0_MCL1-01      YSGLPASA------------------------------------------
A0A3B3SG34_MCL1-01      YTGLCATL------------------------------------------
A0A3Q2Y539_MCL1-01      FTGLSTAA------------------------------------------
Q4SW32_MCL1-01          VTGISRAQ------------------------------------------
Q0KFR9_MCL1-01          YTGLSQPR------------------------------------------
A0A3P8Y1W8_MCL1-02      YTGLSQPR------------------------------------------
A0A3P8Y1W8_MCL1-01      YTGLSQPR------------------------------------------
D2ITA0_MCL1-03          YAGASKAK------------------------------------------
D2ITA0_MCL1-04          YAGASKAK------------------------------------------
A0A3P9ILF6_MCL1-02      FVGISQYP------------------------------------------
A0A3P9ILF6_MCL1-01      FVGISQYP------------------------------------------
A0A3Q2XZL8_MCL1-01      FTGLSTAS------------------------------------------
A0A3B4AFB7_MCL1-02      FTGISQPK------------------------------------------
A0A3B3VM25_MCL1-01      FTGLSKCR------------------------------------------
I3KXG5_MCL1-01          FTGLSQPQ------------------------------------------
A0A3Q0R633_MCL1-01      FTGLSQRR------------------------------------------
A0A3Q0R633_MCL1-03      FTGLSQRR------------------------------------------
A0A3B4T8L9_MCL1-02      FTGRSIPR------------------------------------------
A0A3B4T8L9_MCL1-01      FTGRSIPR------------------------------------------
A0A3Q1EQB9_MCL1-02      FTGLSKPR------------------------------------------
A0A3B4ZKP6_MCL1-01      FTGLSKPR------------------------------------------
A0A3Q1BKL8_MCL1-02      FTGLSKPR------------------------------------------
A0A3Q1EQB9_MCL1-01      FTGLSKPR------------------------------------------
A0A3Q1BKL8_MCL1-01      FTGLSKPR------------------------------------------
A0A3P8RQX7_MCL1-02      FTGLSKPR------------------------------------------
A0A3P8RQX7_MCL1-01      FTGLSKPR------------------------------------------
G3PJT0_MCL1-01          FTGLSKTQ------------------------------------------
A0A3B3IJ04_MCL1-01      FVGISQYR------------------------------------------
A0A3P9L1F3_MCL1-01      FVGISQYR------------------------------------------
A0A3B3IJ04_MCL1-02      FVGISQYR------------------------------------------
A0A3P9L1F3_MCL1-02      FVGISQYR------------------------------------------
A0A3B3CEX1_MCL1-01      YVGLSQSR------------------------------------------
A0A3B3CEX1_MCL1-02      YVGLSQSR------------------------------------------
A0A3Q3VP02_MCL1-01      LSGHGRAR------------------------------------------
A0A3Q3B4P5_MCL1-01      FTGLSKRQ------------------------------------------
A0A3Q3B4P5_MCL1-02      FTGLSKRQ------------------------------------------
A0A3Q2EDX8_MCL1-01      FTGLPKQR------------------------------------------
A0A3Q2P7X9_MCL1-01      FTGLSGHR------------------------------------------
A0A3Q2P7X9_MCL1-02      FTGLSGHR------------------------------------------
A0A3B5PQ55_MCL1-01      FTGLSKCR------------------------------------------
A0A3B5PQ55_MCL1-02      FTGLSKCR------------------------------------------
A0A3P9Q4I8_MCL1-01      FTGLSKCR------------------------------------------
A0A3P9Q4I8_MCL1-02      FTGLSKCR------------------------------------------
A0A087X830_MCL1-01      FTGLSKCR------------------------------------------
A0A3B3YCD0_MCL1-01      FTGLSKCR------------------------------------------
I3JHR5_MCL1-02          FTGLSQPQ------------------------------------------
I3JHR5_MCL1-03          FTGLSQPQ------------------------------------------
I3JHR5_MCL1-01          FTGLSQPQ------------------------------------------
A0A3Q4HLQ8_MCL1-01      FTGLSQPQ------------------------------------------
A0A3P8NP63_MCL1-02      FIGLSQPQ------------------------------------------
A0A3Q2VNL8_MCL1-01      FTGLSQPQ------------------------------------------
A0A3P8NP63_MCL1-01      FIGLSQPQ------------------------------------------
A0A3P9BVM3_MCL1-01      FIGLSQPQ------------------------------------------
A0A3B4G4Z6_MCL1-01      FTGLSQPQ------------------------------------------
A0A2U9CJ81_MCL1-01      YVARTDPR------------------------------------------
A0A3P8VKM5_MCL1-03      FTTHSPSK------------------------------------------
A0A3P8VKM5_MCL1-04      FTTHSPSK------------------------------------------
A0A3P8VKM5_MCL1-05      FTTHSPSK------------------------------------------
A0A3Q3IZW0_MCL1-01      YTGLSTHR------------------------------------------
A0A3Q1GX28_MCL1-02      FSGLTKPR------------------------------------------
A0A3Q1GX28_MCL1-01      FSGLTKPR------------------------------------------
A0A3B4XKA5_MCL1-01      FTGRSIQR------------------------------------------
A0A3Q3GP42_MCL1-01      HTGLSKPG------------------------------------------
A0A3Q3M6G2_MCL1-01      VSGLSKPR------------------------------------------
A0A3Q3M6G2_MCL1-02      VSGLSKPR------------------------------------------
A0A3B1IEV7_MCL1-01      YLG--QKP------------------------------------------
A0A3B4CGU9_MCL1-03      YIG--QKT------------------------------------------
A0A3B4CGU9_MCL1-02      Y-----RS------------------------------------------
A0A3B4AFB7_MCL1-01      FTGISQPK------------------------------------------
Q8UWD6_MCL1-01          FTGLPHSK------------------------------------------
A2BF68_MCL1-01          FTGLPHSK------------------------------------------
Q568W5_MCL1-01          FTGLPHSK------------------------------------------
A0A3B1K5R1_MCL1-01      FCGLSRSC------------------------------------------
A0A3B4C6H5_MCL1-03      FTGLSRSC------------------------------------------
A0A3B4C6H5_MCL1-01      FTGLSRSC------------------------------------------
A0A3P8V8T6_MCL1-01      FTTKSTQR------------------------------------------
H3AR18_MCL1-01          VA-GCEST------------------------------------ETAFRF
G3TVG9_MCL1-01          QAIGATQG------------------------------------RQL---
J7H260_MCL1-01          WAGDAKQE------------------------------------D-----
G1PZ39_MCL1-01          QATGAKDA------------------------------------KPLGGP
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          QATGSKDA------------------------------------KPLGEA
A5PJR2_MCL1-01          QATGAKDA------------------------------------KPLGGS
A0A452GA25_MCL1-01      QATGAKDA------------------------------------KPLGGS
G1L3L7_MCL1-01          QATGAKDA------------------------------------KPLGGS
G1T2Q0_MCL1-01          QATGAKDA------------------------------------KPMGRA
F7AVA6_MCL1-01          QATGTKDT------------------------------------KPMGGS
A0A337S3J9_MCL1-01      QATGAKDA------------------------------------KPLGGS
A0A337S3J9_MCL1-03      QATGAKDA------------------------------------KPLGGS
Q7YRZ9_MCL1-01          QATGAKDA------------------------------------KPLGGS
F1PAP1_MCL1-01          QATGAKDA------------------------------------KPLGGS
Q8HYS5_MCL1-01          QATGAKDA------------------------------------KPLGGS
M3XZZ5_MCL1-01          QATGAKDA------------------------------------KPLGGP
A0A452RHX5_MCL1-01      QATGAKDA------------------------------------KPLGGS
H0XFB7_MCL1-01          QATGAKDA------------------------------------KPMGRA
F7GTF7_MCL1-01          QATGAKDT------------------------------------KPMGRS
A0A2K5CFH3_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K6V5Y3_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K6KRW9_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K5XSB2_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A0D9RZP5_MCL1-01      QATGAKDT------------------------------------KPMSRS
I7G687_MCL1-01          QATGAKDT------------------------------------KPMGRS
A0A2K5LXU8_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2I3GJZ3_MCL1-02      QATGAKDT------------------------------------KPMGRS
H2N5Y9_MCL1-01          QATGAKDT------------------------------------KPLGRS
A0A2R9BPJ5_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2I3RTV4_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2I2YQH7_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K5C7L5_MCL1-01      QATGAKDT------------------------------------KPMDRS
A0A2K5I9I0_MCL1-02      QATGAKDT------------------------------------QPMGRS
A0A2K6GI15_MCL1-01      QATGAKDA------------------------------------KPMGRS
A0A2I3GJZ3_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K5CFH3_MCL1-03      QATGAKDT------------------------------------KPMGRS
A0A2K5R5E2_MCL1-03      QATGAKDT------------------------------------KPMGRS
A0A2K5W0W9_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K6ECR0_MCL1-02      QATGAKDT------------------------------------KPMGRS
A0A2I3LFM0_MCL1-01      QATGAKDT------------------------------------KPMGRS
A0A2K6KRW9_MCL1-02      QATGAKDT------------------------------------KPMGRS
A0A2K6PPI3_MCL1-02      QATGAKDT------------------------------------KPMGRS
G3WBC5_MCL1-01          QAVGTKDT------------------------------------KPL---
W5QI41_MCL1-01          QATGTKDA------------------------------------KPLGGS
F1MQX4_MCL1-01          QATGAKDV------------------------------------KPLGGS
B4DLY8_MCL1-01          ARPPPKDT------------------------------------KPMGRS
B4DG83_MCL1-01          QATGAKDT------------------------------------KPMGRS
B4E3L8_MCL1-01          QATGAKDT------------------------------------KPMGRS
A0A2K5DMS4_MCL1-01      -ATGAKDT------------------------------------KPMGRS
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          EVAGCEST------------------------------------ETAFRF
B6V6J0_MCL1-01          EESGELEA------------------------------------SCLLQH
H0XHA5_MCL1-01          QETG----------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          -RAGARDQ------------------------------------SQGPRV
H9GEA6_MCL1-01          AADEAGSKGTGPKFSFQ---------------------------GLLGRF
H9GEA6_MCL1-02          AADEAGSKGTGPKFSFQ---------------------------GLLGRF
A0A493U0E8_MCL1-01      QKRAPEPAGRRDAAPPAAGCCTFKKCKRFRAGPHPFPHHPAGRDFWGFTT
A0A1L1RNM6_MCL1-01      AAGEAEPGVKK-----------------------LFPGLLGGPGRPGRAS
A0A1L1RNM6_MCL1-02      AAGEAEPGVKK-----------------------LFPGLLGGPGRPGRAS
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          QAVGTKEA------------------------------------KPL---
F6ZMX1_MCL1-02          QAVGTKEA------------------------------------KPL---
F6ZMX1_MCL1-03          QAVGTKEA------------------------------------KPL---
G1T2Q0_MCL1-02          -ATGAKDA------------------------------------KPMGRA
F1PAP1_MCL1-02          -ATGAKDA------------------------------------KPLGGS
A0A337S3J9_MCL1-04      -ATGAKDA------------------------------------KPLGGS
F7AVA6_MCL1-02          -ATGTKDT------------------------------------KPMGGS
A0A2K6GI15_MCL1-03      -ATGAKDA------------------------------------KPMGRS
C8YZ26_MCL1-01          -ATGAKDT------------------------------------KPMGRS
F7GTF7_MCL1-02          -ATGAKDT------------------------------------KPMGRS
A0A2K5R5E2_MCL1-04      -ATGAKDT------------------------------------KPMGRS
A0A2K6V5Y3_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2K5LXU8_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2K5I9I0_MCL1-03      -ATGAKDT------------------------------------QPMGRS
A0A2I2YQH7_MCL1-03      -ATGAKDT------------------------------------KPMGRS
Q07820_MCL1-04          -ATGAKDT------------------------------------KPMGRS
A0A2K5W0W9_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2K6ECR0_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2K5XSB2_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2R9BPJ5_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2I3RTV4_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2I3LFM0_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A2K6PPI3_MCL1-03      -ATGAKDT------------------------------------KPMGRS
A0A286Y1M5_MCL1-01      QAAGAKDS------------------------------------KPLGGV
P97287_MCL1-01          QATGSKDS------------------------------------KPLGEA
A0A452GA25_MCL1-02      QATGAKDA------------------------------------KPLGGS
G3T756_MCL1-01          QATGAKDT------------------------------------KPMGGS
A0A1S3F3I1_MCL1-01      QATGAKDA------------------------------------KPLGGA
G1L3L7_MCL1-02          QATGAKDA------------------------------------KPLGGS
A0A287BK44_MCL1-02      QATGAKDA------------------------------------KPMGGS
A0A287BK44_MCL1-01      QATGAKDA------------------------------------KPMGGS
B4DU51_MCL1-01          QATGAKDT------------------------------------KPMGRS
A0A287DCH9_MCL1-02      QATGSKDA------------------------------------KPLRGS
A0A287DCH9_MCL1-01      QATGSKDA------------------------------------KPLRGS
                                                                          

A2BF68_MCL1-02          --------------MILW------------------TLSGMIARLNLEQK
Q568V1_MCL1-01          -----RKLH-----HAIP-TMKRVVD--NILVKHQIAYKGMIQRLQLDSQ
Q1L8X3_MCL1-01          -----RKLH-----HAIP-TMKRVVD--NILVKHQIAYKGMIQRLQLDSQ
Q9I9N3_MCL1-01          -----RKLH-----HAIP-TMKRVVD--NILVKHQIAYKGMIQRLQLDSQ
W5MMB7_MCL1-01          ------SRG-----KALE-TLKRVVD--SVVAKHQIAYHGMIAKLELENK
A0A3B3R4U0_MCL1-01      ------SRH-----KAYP-VLRRVAE--TVIGKHLIAYNGMIKKLELDKR
A0A3B3SG34_MCL1-01      -----QRRN-----EALS-TLKRVVA--TVVEKHKFAYNGMIGKLSLNQQ
A0A3Q2Y539_MCL1-01      -----WIQS-----KAQS-TMKRVVT--RLVDKHRILFNNMVNELSLDQR
Q4SW32_MCL1-01          -----WRES-----RALA-TTKRVVG--DLMEKHRYTYRGMINKLFMEDR
Q0KFR9_MCL1-01          -----WTQS-----KPLT-TMKRVVE--DVIAKHRYAYNGMVAKLDLDDR
A0A3P8Y1W8_MCL1-02      -----WKQN-----KSLV-TMKRVVG--DVIAKHTYAYKGMISKLCLDDQ
A0A3P8Y1W8_MCL1-01      -----WKQN-----KSLV-TMKRVVG--DVIAKHTYAYKGMISKLCLDDQ
D2ITA0_MCL1-03          -----RTRQ-----DEVQVTMRRVVD--GVLEKHQYAYKGMIQKLELDGR
D2ITA0_MCL1-04          -----RTRQ-----DEVQVTMRRVVD--GVLEKHQYAYKGMIQKLELDGR
A0A3P9ILF6_MCL1-02      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3P9ILF6_MCL1-01      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3Q2XZL8_MCL1-01      -----WNES-----KAHS-TMKRVVA--KVLEKHKYKYNGIINKLSLDDR
A0A3B4AFB7_MCL1-02      -----WKQR-----PALS-TMKGVVD--KLLEKHRYAYNGMINKLALDDR
A0A3B3VM25_MCL1-01      -----WSQN-----KALS-TMKRVVE--DVLSKHRYAYNGMLNRLALDNQ
I3KXG5_MCL1-01          -----RKET-----KALK-MMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3Q0R633_MCL1-01      -----WKES-----EALK-TMKRVVA--DVLEKHRYAYNGMVNKLSLDER
A0A3Q0R633_MCL1-03      -----WKES-----EALK-TMKRVVA--DVLEKHRYAYNGMVNKLSLDER
A0A3B4T8L9_MCL1-02      -----WTEH-----RALQ-TMKRVVD--GVLEKHRYAYNGMINKLSLDNT
A0A3B4T8L9_MCL1-01      -----WTEH-----RALQ-TMKRVVD--GVLEKHRYAYNGMINKLSLDNT
A0A3Q1EQB9_MCL1-02      -----WNES-----KALS-TMKRVVD--DVLDKHRYSYNGMINKLSLDDI
A0A3B4ZKP6_MCL1-01      -----WNEG-----KALS-TMKRVVE--DVLEKHRYAYNGMINKLSLDDR
A0A3Q1BKL8_MCL1-02      -----WNES-----KALS-TMKRVVD--DVLDKHRYAYNGMINKLSLDDR
A0A3Q1EQB9_MCL1-01      -----WNES-----KALS-TMKRVVD--DVLDKHRYSYNGMINKLSLDDI
A0A3Q1BKL8_MCL1-01      -----WNES-----KALS-TMKRVVD--DVLDKHRYAYNGMINKLSLDDR
A0A3P8RQX7_MCL1-02      -----WNES-----KALS-TMKRVVD--DVLDKHRYAYNGMINKLSLDDR
A0A3P8RQX7_MCL1-01      -----WNES-----KALS-TMKRVVD--DVLDKHRYAYNGMINKLSLDDR
G3PJT0_MCL1-01          -----WNPS-----RELT-TMKRVVG--DVLEKHRYVFNGMVNKLSLDDR
A0A3B3IJ04_MCL1-01      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3P9L1F3_MCL1-01      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3B3IJ04_MCL1-02      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3P9L1F3_MCL1-02      -----HRDN-----KYMS-TAKRVVN--DVLEKHKITYNGMIVRLSLDDQ
A0A3B3CEX1_MCL1-01      -----HRES-----KYIS-TAKRVVN--DMMDKHRFAFNGMINRLSLEDN
A0A3B3CEX1_MCL1-02      -----HRES-----KYIS-TAKRVVN--DMMDKHRFAFNGMINRLSLEDN
A0A3Q3VP02_MCL1-01      -----WTES-----RTLS-TMKRVVA--ELLEKHRYVYNGMTKRLSLADT
A0A3Q3B4P5_MCL1-01      -----WSES-----KELS-TMNRVVE--DLLTKHRFAYNGIIKKLSLDDK
A0A3Q3B4P5_MCL1-02      -----WSES-----KELS-TMNRVVE--DLLTKHRFAYNGIIKKLSLDDK
A0A3Q2EDX8_MCL1-01      -----RNQT-----KALS-TMKRVVE--DVLSKHRYAYNGMMNKLCLDEV
A0A3Q2P7X9_MCL1-01      -----WYTK-----KSLS-TMKRVVE--DLLSKHRYAYTGMIRKLNLDQK
A0A3Q2P7X9_MCL1-02      -----WYTK-----KSLS-TMKRVVE--DLLSKHRYAYTGMIRKLNLDQK
A0A3B5PQ55_MCL1-01      -----WGQN-----KALS-TMKRVVE--DLLSKHKYAYNGMVNRLALDNE
A0A3B5PQ55_MCL1-02      -----WGQN-----KALS-TMKRVVE--DLLSKHKYAYNGMVNRLALDNE
A0A3P9Q4I8_MCL1-01      -----WSQN-----KALS-TMKRVVE--DVLSKHRYAYNGMLSKLALDNQ
A0A3P9Q4I8_MCL1-02      -----WSQN-----KALS-TMKRVVE--DVLSKHRYAYNGMLSKLALDNQ
A0A087X830_MCL1-01      -----WSQN-----KALS-TMKRVVE--DVLSKHRYAYNGMLNRLALDNQ
A0A3B3YCD0_MCL1-01      -----WSQN-----KALS-TMKRVVE--DVLSKHRYAYNGMLNRLALDNQ
I3JHR5_MCL1-02          -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
I3JHR5_MCL1-03          -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
I3JHR5_MCL1-01          -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3Q4HLQ8_MCL1-01      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3P8NP63_MCL1-02      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3Q2VNL8_MCL1-01      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3P8NP63_MCL1-01      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3P9BVM3_MCL1-01      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A3B4G4Z6_MCL1-01      -----RKET-----KALK-TMKRVVA--DVLEKHRYAYNGMINKLSLDER
A0A2U9CJ81_MCL1-01      -----WTDS-----KALS-TMKRVVD--RLVEKHRYAYNGMMNRLSLDNR
A0A3P8VKM5_MCL1-03      -----WGER-----KALT-TMKRVVD--DVLEKHRYAYNGMINKLSLENR
A0A3P8VKM5_MCL1-04      -----WGER-----KALT-TMKRVVD--DVLEKHRYAYNGMINKLSLENR
A0A3P8VKM5_MCL1-05      -----WGER-----KALT-TMKRVVD--DVLEKHRYAYNGMINKLSLENR
A0A3Q3IZW0_MCL1-01      -----WTRR-----KTLS-TMKRVVE--GVLEKHRYAYKGMINKLSLDER
A0A3Q1GX28_MCL1-02      -----WCET-----KELS-TMKRVVN--DVLEKHRYAYNGMINKLSLDDK
A0A3Q1GX28_MCL1-01      -----WCET-----KELS-TMKRVVN--DVLEKHRYAYNGMINKLSLDDK
A0A3B4XKA5_MCL1-01      -----RTEH-----RALQ-TMKRVVE--GVLEKHRYAYNGMINKLSLDNR
A0A3Q3GP42_MCL1-01      -----WNES-----SALS-TMKRVVE--DVLAKHRYAYNGMINKLSLEDR
A0A3Q3M6G2_MCL1-01      -----WHDS-----KALS-TMKRVVE--DLLEKYRYTYNGMINKLSLDDR
A0A3Q3M6G2_MCL1-02      -----WHDS-----KALS-TMKRVVE--DLLEKYRYTYNGMINKLSLDDR
A0A3B1IEV7_MCL1-01      -----REQS-----PALR-TMSRVVA--GVVLKHGIAYNGMVQKLNLEEQ
A0A3B4CGU9_MCL1-03      -----RDQH-----PAHG-TMSRVVE--GVILKHSIAYNGMVQRLCLEQQ
A0A3B4CGU9_MCL1-02      -----RNQH-----PASD-TLSRVVE--GMLHKHSVAYSGMVQRLCLEQQ
A0A3B4AFB7_MCL1-01      -----WKQR-----PALS-TMKGVVD--KLLEKHRYAYNGMINKLALDDR
Q8UWD6_MCL1-01          -----SGRK-----QVLS-TMRRVVD--NLAVKHELAYKGMIARLNLEQK
A2BF68_MCL1-01          -----SGRK-----QVLS-TMRRVVD--NLAVKHELAYKGMIARLNLEQK
Q568W5_MCL1-01          -----SGRK-----QVLS-TMRRVVD--NLAVKHELAYKGMIARLNLEQK
A0A3B1K5R1_MCL1-01      -----GGHG-----AVVQ-TMKRVVD--DLVVKHGIAYKGMLNKLGMEDR
A0A3B4C6H5_MCL1-03      -----GRHR-----GVVQ-TIRRVVD--GLVVKHELVYKGMFTRLGMEDR
A0A3B4C6H5_MCL1-01      -----GRHR-----GVVQ-TIRRVVD--GLVVKHELVYKGMFTRLGMEDR
A0A3P8V8T6_MCL1-01      -----LVES-----KALS-TMKRVVK--GILDKHRHAFSGMINNLSFENG
H3AR18_MCL1-01          GLDQWSGGE-----KPLD-TLRRVGD--SIIDKHRIAFNGMQQKLNIHKE
G3TVG9_MCL1-01          --------------EGVR-NLPRVAD--GVQRNEETVSQGMLRKPDFKNE
J7H260_MCL1-01          -----GDSP-----KALP-TMRRLGG--DINEKHRMAFQGMLQKLSIQRP
G1PZ39_MCL1-01          A----ASSR-----KALE-TLRRVGD--GVQRNHEMAFQG---------E
Q95KR3_MCL1-01          ----------------------------------SSAFQGMLRKLDIKNE
A0A2K5EPX0_MCL1-02      ------------------------------------TC--MLRKLDIKNK
A0A2K5EPX0_MCL1-01      ------------------------------------SSPGMLRKLDIKNK
Q9Z1P3_MCL1-01          G----AAGR-----RALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A5PJR2_MCL1-01          G----TTSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A452GA25_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
G1L3L7_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
G1T2Q0_MCL1-01          G----SASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F7AVA6_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A337S3J9_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A337S3J9_MCL1-03      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
Q7YRZ9_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F1PAP1_MCL1-01          R----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
Q8HYS5_MCL1-01          R----AASR-----KALE-TLQRVGD--GVQRNHETAFQGMLRKLDIKNE
M3XZZ5_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A452RHX5_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
H0XFB7_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F7GTF7_MCL1-01          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5CFH3_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6V5Y3_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6KRW9_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5XSB2_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A0D9RZP5_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
I7G687_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5LXU8_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I3GJZ3_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
H2N5Y9_MCL1-01          G----ATCR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2R9BPJ5_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I3RTV4_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I2YQH7_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5C7L5_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQ-----V-----
A0A2K5I9I0_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K6GI15_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2I3GJZ3_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K5CFH3_MCL1-03      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K5R5E2_MCL1-03      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K5W0W9_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K6ECR0_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2I3LFM0_MCL1-01      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K6KRW9_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
A0A2K6PPI3_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGWVCGV-----
G3WBC5_MCL1-01          ------RSG-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
W5QI41_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F1MQX4_MCL1-01          G----ATSR-----KALE-TLHRVGD--GVQHNHETAFQGMLQKLDIKNE
B4DLY8_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
B4DG83_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
B4E3L8_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5DMS4_MCL1-01      E----AANS-----KALE-TLRGVGE--GVPRNHEMALQGMLRNLDNKNE
U3KKY6_MCL1-01          -------------------------------KKNKKNLPGMLRKLEIQQE
G1MPY7_MCL1-01          -------------------------------------FSGMLRKLEIKKE
K7FPN7_MCL1-01          ---------------------------------------GMLRKLDIKNE
H3AR18_MCL1-02          G----LDQWSGGE-KPLD-TLRRVGD--SIIDKHRIAFNGMQQKLNIHKE
B6V6J0_MCL1-01          G----VHH------KALE-TLLRVGG--EIIEKHHMAFTGMLQRLSIHSR
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------WAWL-GLK--------------AFQGMLQKLDIKNE
G1QAV8_MCL1-01          G----GVQR-------------RAAGCSGVRQ--ETAFLGML-ELDTENE
H9GEA6_MCL1-01          G----SSPNEAEVARALE-TLRRVGE--SLREKHLLAFQGMLRKLEIKKE
H9GEA6_MCL1-02          G----SSPNEAEVARALE-TLRRVGE--SLREKHLLAFQGMLRKLEIKKE
A0A493U0E8_MCL1-01      P----GQIF-----GVLA-RKPHSGEQGGVTVEDLGRSLGMLRKLEIKKE
A0A1L1RNM6_MCL1-01      S----AVME-----KALE-TLRRVGD--GVMQKHELAFQGMLRKLEIKKE
A0A1L1RNM6_MCL1-02      S----AVME-----KALE-TLRRVGD--GVMQKHELAFQGMLRKLEIKKE
G2HFR3_MCL1-01          --------------------------------------------LDIKNE
F6ZMX1_MCL1-01          ------RSG-----KALE-TLRRVGD--GVQRNHERAFQGMLRKLDIKNE
F6ZMX1_MCL1-02          ------RSG-----KALE-TLRRVGD--GVQRNHERAFQGMLRKLDIKNE
F6ZMX1_MCL1-03          ------RSG-----KALE-TLRRVGD--GVQRNHERAFQGMLRKLDIKNE
G1T2Q0_MCL1-02          G----SASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F1PAP1_MCL1-02          R----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A337S3J9_MCL1-04      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
F7AVA6_MCL1-02          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6GI15_MCL1-03      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
C8YZ26_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRRLDIKNE
F7GTF7_MCL1-02          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5R5E2_MCL1-04      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6V5Y3_MCL1-03      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5LXU8_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5I9I0_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I2YQH7_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
Q07820_MCL1-04          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5W0W9_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6ECR0_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K5XSB2_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2R9BPJ5_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I3RTV4_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2I3LFM0_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A2K6PPI3_MCL1-03      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A286Y1M5_MCL1-01      G----PTSR-----KALE-TLRRVGD--GVQRNHQTAFQGMLRKLDIKNE
P97287_MCL1-01          G----AAGR-----RALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A452GA25_MCL1-02      G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
G3T756_MCL1-01          G----AASR-----KALE-TLRRVAD--GVQRNHETAFQGMLRKLDIKNE
A0A1S3F3I1_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
G1L3L7_MCL1-02          G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A287BK44_MCL1-02      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A287BK44_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
B4DU51_MCL1-01          G----ATSR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A287DCH9_MCL1-02      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
A0A287DCH9_MCL1-01      G----AASR-----KALE-TLRRVGD--GVQRNHETAFQGMLRKLDIKNE
                                                                          

A2BF68_MCL1-02          GEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKYVRL
Q568V1_MCL1-01          PASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQCVER
Q1L8X3_MCL1-01          PASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQCVER
Q9I9N3_MCL1-01          PASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQCVER
W5MMB7_MCL1-01          GEDVSFVTGVAKSLFSDGKTNWGRIASLVSFGAVVAKQMKDSGRESCVEA
A0A3B3R4U0_MCL1-01      GDDTSFVTKVAEEIFSDKVTNWGRIASLIAFGGVVCKYLKDHGQTNCVDD
A0A3B3SG34_MCL1-01      SDDMTVIKTVAERIFSDGTTNWGRIASLVAFGAEVCKYLKETGREHCVEA
A0A3Q2Y539_MCL1-01      GLDRSFVSQVAQTEFANGNINWGRIASLLAFCAVLSQALKENQQERCVEL
Q4SW32_MCL1-01          VGDVSFVGAVAKSTFEDGNTNWGRVASLLAFAAVVAQYLNDHGQRDCVEQ
Q0KFR9_MCL1-01          CDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVEL
A0A3P8Y1W8_MCL1-02      GDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVEL
A0A3P8Y1W8_MCL1-01      GDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVEL
D2ITA0_MCL1-03          GEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSL
D2ITA0_MCL1-04          GEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSL
A0A3P9ILF6_MCL1-02      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3P9ILF6_MCL1-01      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3Q2XZL8_MCL1-01      GDNVSFISEVAKSLFSDGTTNWGRVASLVAFGAIVSQHLKEKGRAHCVEP
A0A3B4AFB7_MCL1-02      GDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGAVVCQYLKTKGRESCVER
A0A3B3VM25_MCL1-01      PDNMGFVTEVAQNLFSDGTTNWGRIVSLVAFGAAVCQHLKERGREHCVEL
I3KXG5_MCL1-01          EEDMSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVVL
A0A3Q0R633_MCL1-01      GEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVEL
A0A3Q0R633_MCL1-03      GEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVEL
A0A3B4T8L9_MCL1-02      GDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRENCVES
A0A3B4T8L9_MCL1-01      GDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRENCVES
A0A3Q1EQB9_MCL1-02      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3B4ZKP6_MCL1-01      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3Q1BKL8_MCL1-02      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3Q1EQB9_MCL1-01      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3Q1BKL8_MCL1-01      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3P8RQX7_MCL1-02      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
A0A3P8RQX7_MCL1-01      GDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDL
G3PJT0_MCL1-01          GDDASFVREVATSLFADGTTNWGRIASLVAFGAVVCQHLAERGRGNCVEL
A0A3B3IJ04_MCL1-01      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3P9L1F3_MCL1-01      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3B3IJ04_MCL1-02      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3P9L1F3_MCL1-02      GDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDL
A0A3B3CEX1_MCL1-01      LDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRGHSVDL
A0A3B3CEX1_MCL1-02      LDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRGHSVDL
A0A3Q3VP02_MCL1-01      QDNVSFVSTVSRDLFSDGATNWGRIASLVAFGVVVSQCLKENGKSDRVEL
A0A3Q3B4P5_MCL1-01      SEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGREECVEL
A0A3Q3B4P5_MCL1-02      SEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGREECVEL
A0A3Q2EDX8_MCL1-01      PDNMGFVSSVATSLFSDGTTNWGRIVSLVAFGAVVCQHLKEKGRENCVEL
A0A3Q2P7X9_MCL1-01      SDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDL
A0A3Q2P7X9_MCL1-02      SDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDL
A0A3B5PQ55_MCL1-01      PDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGREHCVEL
A0A3B5PQ55_MCL1-02      PDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGREHCVEL
A0A3P9Q4I8_MCL1-01      PDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGREHCVDL
A0A3P9Q4I8_MCL1-02      PDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGREHCVDL
A0A087X830_MCL1-01      PDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGAAVCQHLKERGREHCVEL
A0A3B3YCD0_MCL1-01      PDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGAAVCQHLKERGREHCVEL
I3JHR5_MCL1-02          HEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVAL
I3JHR5_MCL1-03          HEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVAL
I3JHR5_MCL1-01          HEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVAL
A0A3Q4HLQ8_MCL1-01      DEDMSFVGAVAKSLFGDHTTNWGRVVSFVAFGAVVSQHLKEKGRDNCVAL
A0A3P8NP63_MCL1-02      DEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVAL
A0A3Q2VNL8_MCL1-01      DEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVAL
A0A3P8NP63_MCL1-01      DEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVAL
A0A3P9BVM3_MCL1-01      DEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVAL
A0A3B4G4Z6_MCL1-01      DEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVAL
A0A2U9CJ81_MCL1-01      RDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGAVVSQHLKETGRGNCVEL
A0A3P8VKM5_MCL1-03      QGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTEL
A0A3P8VKM5_MCL1-04      QGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTEL
A0A3P8VKM5_MCL1-05      QGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTEL
A0A3Q3IZW0_MCL1-01      GDDMSFVGSVAQSIFADGTTNWGRITSLLAFGAVVCQYLKEKGRENCVEL
A0A3Q1GX28_MCL1-02      VDDVSFITAVAQSLFSDGTTNWGRIASLVAFGAAVCQHLKEKHRENCVDL
A0A3Q1GX28_MCL1-01      VDDVSFITAVAQSLFSDGTTNWGRIASLVAFGAAVCQHLKEKHRENCVDL
A0A3B4XKA5_MCL1-01      GDDVRFVGAVAKSLFADGTTNWGRIASLVAFGVVVCQHMKDTGRENCVES
A0A3Q3GP42_MCL1-01      GDDASFVSAVAKSLFADGTTNWGRIASLVAFGAAVSQYLKENGRGHCVEL
A0A3Q3M6G2_MCL1-01      GDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRGDCVEL
A0A3Q3M6G2_MCL1-02      GDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRGDCVEL
A0A3B1IEV7_MCL1-01      DDSMDIISSVAKALFSDGTTNWGRIVSLVAFGAVVCDHLKKKSRDHCVEN
A0A3B4CGU9_MCL1-03      DDSMEFISSVAKTLFNDGTTNWGRIASLVAFGAVVCEQMKEAGREQCVEN
A0A3B4CGU9_MCL1-02      DDSMEFISSVAKTLFDDGITNWGRIASLVALGAVVCEWLKEVGREQCVEN
A0A3B4AFB7_MCL1-01      GDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGAVVCQYLKTKGRESCVER
Q8UWD6_MCL1-01          GEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKYVRL
A2BF68_MCL1-01          GEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKYVRL
Q568W5_MCL1-01          GEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKYVRL
A0A3B1K5R1_MCL1-01      GDDMYVIRAVAKELFSDGITNWGRVASLVAFGAVVSKHQHDMGRGHCVSL
A0A3B4C6H5_MCL1-03      GDDMHIIRTVAKELFSDGITNWGRIASLLAFGAVVCQHQNQMGRGHCVSL
A0A3B4C6H5_MCL1-01      GDDMHIIRTVAKELFSDGITNWGRIASLLAFGAVVCQHQNQMGRGHCVSL
A0A3P8V8T6_MCL1-01      VYNIGVVGAVARSLFRDGTSNWGRIVSLVAFGAVLCQHLKEKGWENTVDQ
H3AR18_MCL1-01          D-DLHIIPEIGNQIFKDGATNWGRIVSLIAFGAVVAKKLKKMNLEDSIEQ
G3TVG9_MCL1-01          N-DVKSLSGAMVHVFSGGITKWGRIVT-ISFGAFVVKHFGSINQEAA---
J7H260_MCL1-01          E-DIQKLSEVPSMVFSDGVTNWGRIVTVISFGAFVAKHLKSIHMENCVGI
G1PZ39_MCL1-01          R-GPRALCLVRDRWAPVGGNRDEPGLEGLS-ARFRNQHILAMSH--CFRP
Q95KR3_MCL1-01          D-DVKSLSRVMVHVLSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A2K5EPX0_MCL1-02      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5EPX0_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
Q9Z1P3_MCL1-01          D-DVKSFSRVMTHVFKDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A5PJR2_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A452GA25_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
G1L3L7_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEP
G1T2Q0_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F7AVA6_MCL1-01          D-DVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A337S3J9_MCL1-01      N-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A337S3J9_MCL1-03      N-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
Q7YRZ9_MCL1-01          N-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F1PAP1_MCL1-01          D-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
Q8HYS5_MCL1-01          D-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
M3XZZ5_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A452RHX5_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
H0XFB7_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F7GTF7_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5CFH3_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K6V5Y3_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K6KRW9_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5XSB2_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A0D9RZP5_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
I7G687_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5LXU8_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I3GJZ3_MCL1-02      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
H2N5Y9_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2R9BPJ5_MCL1-01      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I3RTV4_MCL1-01      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I2YQH7_MCL1-01      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5C7L5_MCL1-01      -------------LPCRRPRRW---------------------HQKCAAG
A0A2K5I9I0_MCL1-02      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K6GI15_MCL1-01      -------------LPCRGPRRR---------------------HQKCAAG
A0A2I3GJZ3_MCL1-01      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K5CFH3_MCL1-03      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K5R5E2_MCL1-03      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K5W0W9_MCL1-01      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K6ECR0_MCL1-02      -------------LPCRGPRRW---------------------HQKCAAG
A0A2I3LFM0_MCL1-01      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K6KRW9_MCL1-02      -------------LPCRGPRRW---------------------HQKCAAG
A0A2K6PPI3_MCL1-02      -------------LPCRGPRRW---------------------HQKCAAG
G3WBC5_MCL1-01          E-DIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDP
W5QI41_MCL1-01          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F1MQX4_MCL1-01          D-DVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEP
B4DLY8_MCL1-01          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
B4DG83_MCL1-01          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
B4E3L8_MCL1-01          D-DVKSLSRVMIHVFSDSVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5DMS4_MCL1-01      D-NVKSFY---------GVTNWGRIVTLSSFGAFVAKHLKTINQESCIEP
U3KKY6_MCL1-01          E-DLQSVVEVAAHVFSDGVTNWGRVVTLIAFGAFVAKHLKSIKQEQSITS
G1MPY7_MCL1-01          E-DLQAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISS
K7FPN7_MCL1-01          E-DLKSVSSVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQENCINT
H3AR18_MCL1-02          D-DLHIIPEIGNQIFKDGATNWGRIVSLIAFGAVVAKKLKKMNLEDSIEQ
B6V6J0_MCL1-01          E-DLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSLNLEDCIGV
H0XHA5_MCL1-01          E-DINSLSRVMAHVFSYGVTNWGRIMTLI-FGGFVAKHLKTINQEGYIKP
A0A2K6F6N9_MCL1-01      D-DVKSLSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHLKTINQESCIEP
G1QAV8_MCL1-01          D-NVKSSSQAMVHAFRDGVTN-GRIVTHFFWC--LCSHLKSINQESCIEP
H9GEA6_MCL1-01          E-DLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINT
H9GEA6_MCL1-02          E-DLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINT
A0A493U0E8_MCL1-01      E-DLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQEKSIGS
A0A1L1RNM6_MCL1-01      D-DLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQEKCITS
A0A1L1RNM6_MCL1-02      D-DLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQEKCITS
G2HFR3_MCL1-01          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
F6ZMX1_MCL1-01          E-DIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDP
F6ZMX1_MCL1-02          E-DIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDP
F6ZMX1_MCL1-03          E-DIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDP
G1T2Q0_MCL1-02          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F1PAP1_MCL1-02          D-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A337S3J9_MCL1-04      N-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
F7AVA6_MCL1-02          D-DVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A2K6GI15_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
C8YZ26_MCL1-01          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
F7GTF7_MCL1-02          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5R5E2_MCL1-04      D-DVKSLSRVMVHVFSDGVTNWGRIVTLIYFGAFVAKHLKTINQESCIEP
A0A2K6V5Y3_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5LXU8_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5I9I0_MCL1-03      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I2YQH7_MCL1-03      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
Q07820_MCL1-04          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5W0W9_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K6ECR0_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K5XSB2_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2R9BPJ5_MCL1-03      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I3RTV4_MCL1-03      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2I3LFM0_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A2K6PPI3_MCL1-03      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A286Y1M5_MCL1-01      D-DVKSLSRVVALVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
P97287_MCL1-01          G-DVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEP
A0A452GA25_MCL1-02      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
G3T756_MCL1-01          D-DVKSLSRVMAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIEP
A0A1S3F3I1_MCL1-01      D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
G1L3L7_MCL1-02          D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEP
A0A287BK44_MCL1-02      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A287BK44_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
B4DU51_MCL1-01          D-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A287DCH9_MCL1-02      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
A0A287DCH9_MCL1-01      D-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP
                                            .                             

A2BF68_MCL1-02          VGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA---------
Q568V1_MCL1-01          VAEQISSYLTSEQQDWILKNKSC---HGFVEFFHQEDVESV---------
Q1L8X3_MCL1-01          VAEQISSYLTSEQQDWILKNKSW---HGFVEFFHQEDVESV---------
Q9I9N3_MCL1-01          VAEQISSYLTSEQQDWILKNKSW---HGFVEFFHQEDVESV---------
W5MMB7_MCL1-01          VGQAISNYLLQDQREWLLNNRGW---DGFVEFFRVEDPEST---------
A0A3B3R4U0_MCL1-01      VASRISCYLLEHQRDWLNRNNGW---EGFTDFFYMEDPEST---------
A0A3B3SG34_MCL1-01      VGKQISSYLLSEQRQWLLKNKAW---DGFVEFFHVEDTESL---------
A0A3Q2Y539_MCL1-01      VAQEVSTYLLSHQRTWLVQHNGW---DGFAEFFKEDDLEST---------
Q4SW32_MCL1-01          VAQEISTYLLTDQRDWLIKNNAW---DGFVEFFQVPDPEST---------
Q0KFR9_MCL1-01          VGQEIAKYLLSDQSDWLIKNNAW---NGFVEFFHVQDPESS---------
A0A3P8Y1W8_MCL1-02      VGQEISTYLLTDQRAWLVKNNAW---DGFVEFFHVEDPESS---------
A0A3P8Y1W8_MCL1-01      VGQEISTYLLTDQRAWLVKNNAW---DGFVEFFHVEDPESS---------
D2ITA0_MCL1-03          VAEEISSYLLSDQREWLVKNNSW---EGFVEFFRVSDPETT---------
D2ITA0_MCL1-04          VAEEISSYLLSDQREWLVKNNSW---EGFVEFFRVSDPETT---------
A0A3P9ILF6_MCL1-02      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT---------
A0A3P9ILF6_MCL1-01      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT---------
A0A3Q2XZL8_MCL1-01      VADEISSYLLSHQRNWLVKNNSW---DGFVQFFREVDPEST---------
A0A3B4AFB7_MCL1-02      VGQEISSYLLLDQRDWLVRNNAW---DGFVDFFRVEDPESA---------
A0A3B3VM25_MCL1-01      VIQEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST---------
I3KXG5_MCL1-01          VSQEISAYLLSEQRDWIIKNNAW---DGFVAFVRVADPESI---------
A0A3Q0R633_MCL1-01      VSQEISTYLLSDQRDWLVKNNAW---DGFVEFFRVADPEST---------
A0A3Q0R633_MCL1-03      VSQEISTYLLSDQRDWLVKNNAW---DGFVEFFRVADPEST---------
A0A3B4T8L9_MCL1-02      VGQEISKYLLSDQRDWLVKNNSW---DGFVAFFRVADPESK---------
A0A3B4T8L9_MCL1-01      VGQEISKYLLSDQRDWLVKNNSW---DGFVAFFRVADPESK---------
A0A3Q1EQB9_MCL1-02      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3B4ZKP6_MCL1-01      VSEEISTYLLCDQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3Q1BKL8_MCL1-02      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3Q1EQB9_MCL1-01      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3Q1BKL8_MCL1-01      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3P8RQX7_MCL1-02      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
A0A3P8RQX7_MCL1-01      VSQEISTYLLSEQRDWLVKNNSW---DGFVEFFRVADPELT---------
G3PJT0_MCL1-01          VGQEISAYLLSDQRDWLIKNNAW---VGFVEFFRVADPESA---------
A0A3B3IJ04_MCL1-01      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT---------
A0A3P9L1F3_MCL1-01      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPEST---------
A0A3B3IJ04_MCL1-02      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPETT---------
A0A3P9L1F3_MCL1-02      VSQEICTYLLSEQRNWLVNNNSW---DGFVEFFRVSDPEST---------
A0A3B3CEX1_MCL1-01      VSQEICTYLLREQRDWLINNNSW---DGFVEFFHVPDPEST---------
A0A3B3CEX1_MCL1-02      VSQEICTYLLREQRDWLINNNSW---DGFVEFFHVPDPEST---------
A0A3Q3VP02_MCL1-01      VAHEISTYLLTDQRDWMCVGG-----DGFVEFFRVADPEST---------
A0A3Q3B4P5_MCL1-01      VGQEISTYLLSEQKDWLLKNNSW---SGFVEFFRITDPEST---------
A0A3Q3B4P5_MCL1-02      VGQEISTYLLSEQKDWLLKNNSW---SGFVEFFRITDPEST---------
A0A3Q2EDX8_MCL1-01      VSQEISTYLLQNQRDWLVKNNSW---NGFVEFFRVEDPEAT---------
A0A3Q2P7X9_MCL1-01      VSREISTYLLTNQRDWLAKNNSW---DGFVEFFKVEDTEST---------
A0A3Q2P7X9_MCL1-02      VSREISTYLLTNQRDWLAKNNSW---DGFVEFFKVEDTEST---------
A0A3B5PQ55_MCL1-01      VSRKISTYLLANQRDWLAKNNSW---EGFVEFFRVSDPEST---------
A0A3B5PQ55_MCL1-02      VSRKISTYLLANQRDWLAKNNSW---EGFVEFFRVSDPEST---------
A0A3P9Q4I8_MCL1-01      VSQEISTYLLAKQRDWLAKNNSW---EGFVEFFRVSDPEST---------
A0A3P9Q4I8_MCL1-02      VSQEISTYLLAKQRDWLAKNNSW---EGFVEFFRVSDPEST---------
A0A087X830_MCL1-01      VSKEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST---------
A0A3B3YCD0_MCL1-01      VSKEISTYLLENQRDWLAKNNSW---EGFVEFFRVSDPEST---------
I3JHR5_MCL1-02          VSQEVSAYLLSEQRDWIVKNNAW---DGFVEFFRVADPEST---------
I3JHR5_MCL1-03          VSQEVSAYLLSEQRDWIVKNNAW---DGFVEFFRVADPEST---------
I3JHR5_MCL1-01          VSQEVSAYLLSEQRDWIVKNNAW---DGFVEFFRVADPEST---------
A0A3Q4HLQ8_MCL1-01      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A3P8NP63_MCL1-02      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A3Q2VNL8_MCL1-01      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A3P8NP63_MCL1-01      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A3P9BVM3_MCL1-01      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A3B4G4Z6_MCL1-01      VSQEISAYLLSEQRDWIVKNNAW---DGFVEFFRVADPESI---------
A0A2U9CJ81_MCL1-01      VGQEISTYLLTDQRDWLVKNNSW---EGFVEFFRVADPETT---------
A0A3P8VKM5_MCL1-03      VGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT---------
A0A3P8VKM5_MCL1-04      VGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT---------
A0A3P8VKM5_MCL1-05      VGREISSYLLSYQRDWLLKNNSW---DGFVEFFRVEDPEAT---------
A0A3Q3IZW0_MCL1-01      VGQEISTYLLSHQRDWLVKNNAW---DGFEEFFRVADPEST---------
A0A3Q1GX28_MCL1-02      VAQEISSYLLSAQRDWLVRNNSW---DGFVEFFRVADPEST---------
A0A3Q1GX28_MCL1-01      VAQEISSYLLSAQRDWLVRNNSW---DGFVEFFRVADPEST---------
A0A3B4XKA5_MCL1-01      VGQEISKYLLSDQRDWLVKNNSW---DGFVSFFRVADPESK---------
A0A3Q3GP42_MCL1-01      VGQEISTYLLSDHRDWLVKNNAW---DGFVEFFRVADPEST---------
A0A3Q3M6G2_MCL1-01      VGQEISTYLLSDQRDWLVKNNSW---DGFVEFFRVADPEST---------
A0A3Q3M6G2_MCL1-02      VGQEISTYLLSDQRDWLVKNNSW---DGFVEFFRVADPEST---------
A0A3B1IEV7_MCL1-01      VAQHISTYLNTHQHQWLINNNAW---DGFVEFFREDDSESR---------
A0A3B4CGU9_MCL1-03      VIQHISTYLSTDQRQWLINNKAW---GGFVEFFREDDSESR---------
A0A3B4CGU9_MCL1-02      VIQHISMYLSTDQRQWLINNKAW---GGFVEFFREDDSESR---------
A0A3B4AFB7_MCL1-01      VGQEISSYLLLDQRDWLVRNNAW---DGFVDFFRVEDPESA---------
Q8UWD6_MCL1-01          VGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA---------
A2BF68_MCL1-01          VGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA---------
Q568W5_MCL1-01          VGEEISSYLLTEQRDWILRNKAW---DGFVEFFHVPDTEAA---------
A0A3B1K5R1_MCL1-01      VGEELSSYLLSDERDWLLKNKAW---DGFVEFFRVPDPEST---------
A0A3B4C6H5_MCL1-03      VGQEISSYLLSDQKDWLLKNKAW---DGFVEFFHVPDPESK---------
A0A3B4C6H5_MCL1-01      VGQEISSYLLSDQKDWLLKNKAW---DGFVEFFHVPDPESK---------
A0A3P8V8T6_MCL1-01      VGQEIASYLLSYQKDWLLKNNSW---DGFVEFFQGQEPEKA---------
H3AR18_MCL1-01          LAVSITDFLVQNKGDWILKNQGW---KGFVDFFHVEDAEGT---------
G3TVG9_MCL1-01          -AECITDVLLR-KRYCLDKRRGG---DGLVEFVHVKDPQGD---------
J7H260_MCL1-01          LADSFTDYLMTQKKEWIVEHNGW---DGCVEFFHVEDYESG---------
G1PZ39_MCL1-01          PDSLGTALRSKAGKVWETSNTCHGFKDGFVEFFHVEDLEGG---------
Q95KR3_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5EPX0_MCL1-02      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5EPX0_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
Q9Z1P3_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVQDLEGG---------
A5PJR2_MCL1-01          LAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG---------
A0A452GA25_MCL1-01      LAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG---------
G1L3L7_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
G1T2Q0_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLESG---------
F7AVA6_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A337S3J9_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A337S3J9_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
Q7YRZ9_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
F1PAP1_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
Q8HYS5_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
M3XZZ5_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A452RHX5_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
H0XFB7_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
F7GTF7_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5CFH3_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6V5Y3_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6KRW9_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5XSB2_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A0D9RZP5_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
I7G687_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5LXU8_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I3GJZ3_MCL1-02      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
H2N5Y9_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2R9BPJ5_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I3RTV4_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I2YQH7_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5C7L5_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A2K5I9I0_MCL1-02      FCRCCWS------RSWF---------------------------------
A0A2K6GI15_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A2I3GJZ3_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A2K5CFH3_MCL1-03      FCRCCWS------RSWF---------------------------------
A0A2K5R5E2_MCL1-03      FCRCCWS------RSWF---------------------------------
A0A2K5W0W9_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A2K6ECR0_MCL1-02      FCRCCWS------RSWF---------------------------------
A0A2I3LFM0_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A2K6KRW9_MCL1-02      FCRCCWS------RSWF---------------------------------
A0A2K6PPI3_MCL1-02      FCRCCWS------RSWF---------------------------------
G3WBC5_MCL1-01          LAESITDVLVKSKRDWLMKQKGW---EGFVEFFHVEDLEGG---------
W5QI41_MCL1-01          LAESITDVLVRSKRDWIVKQRGW---DGFVEFFRVEDLEGG---------
F1MQX4_MCL1-01          LAESITDVLVRSKRDWIVKERGW---DGFVEFFHVEDLEGG---------
B4DLY8_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
B4DG83_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
B4E3L8_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5DMS4_MCL1-01      LAESI-------------RYSRW---DGFVEFFRVEDLEGG---------
U3KKY6_MCL1-01          LAGIITDALVSSKRQWLESQGGW---------------------------
G1MPY7_MCL1-01          LAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS---------
K7FPN7_MCL1-01          LAGIITDVLVSDKRDWLVNQRGW---EGFVEFFRVEDLEGS---------
H3AR18_MCL1-02          LAVSITDFLVQNKGDWILKNQGW---KGFVDFFHVEDAEGT---------
B6V6J0_MCL1-01          LAEHFTQFLMMSKKDWIIQEKGW---DGFVDFFHIEDYESG---------
H0XHA5_MCL1-01          LEENIADVLVRTKPDWLVKQRGW---DGFVEFFYLEDLESS---------
A0A2K6F6N9_MCL1-01      LAESITDILVRTKRDWL--------------FFHVEDLEGS---------
G1QAV8_MCL1-01          LAEDITDVLVGTERGWLVKQRGW---DGFVEFFQVEDLEGG---------
H9GEA6_MCL1-01          LIEIITDVLVTDKREWLLKHNAW---HNCV--------------------
H9GEA6_MCL1-02          LIEIITDVLVTDKREWLLKHNAW---EGFVQFFHVEDIEGG---------
A0A493U0E8_MCL1-01      LARIITDALVSSKREWLVSQGGW---EGFVDFFRVEDLEGS---------
A0A1L1RNM6_MCL1-01      LAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS---------
A0A1L1RNM6_MCL1-02      LAGIITDALVSSKREWLMSQGGW---EGFVDFFRVEDLESS---------
G2HFR3_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
F6ZMX1_MCL1-01          LAESITDVLVKTKRDWLIKQKGW---KGLLAQDTEEATRTGDPCAPSSAY
F6ZMX1_MCL1-02          LAESITDVLVKTKRDWLIKQKGW---SGKERVDPRGLVSGG---------
F6ZMX1_MCL1-03          LAESITDVLVKTKRDWLIKQKGW---EGFVEFFHVQDLEGG---------
G1T2Q0_MCL1-02          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLESG---------
F1PAP1_MCL1-02          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A337S3J9_MCL1-04      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
F7AVA6_MCL1-02          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6GI15_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
C8YZ26_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFQVEDLEGG---------
F7GTF7_MCL1-02          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5R5E2_MCL1-04      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6V5Y3_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5LXU8_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5I9I0_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I2YQH7_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
Q07820_MCL1-04          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5W0W9_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6ECR0_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K5XSB2_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2R9BPJ5_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I3RTV4_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2I3LFM0_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A2K6PPI3_MCL1-03      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A286Y1M5_MCL1-01      LAESITDALVHSKRDWLVKQRGW---DGFVEFFHIEDLEGG---------
P97287_MCL1-01          LAETITDVLVRTKRDWLVKQRGW---DGFVEFFHVQDLEGG---------
A0A452GA25_MCL1-02      LAESITDVLVRSKRDWIVKQRGW---DGFVEFFHVEDLEGG---------
G3T756_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A1S3F3I1_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGS---------
G1L3L7_MCL1-02          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A287BK44_MCL1-02      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A287BK44_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
B4DU51_MCL1-01          LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A287DCH9_MCL1-02      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
A0A287DCH9_MCL1-01      LAESITDVLVRTKRDWLVKQRGW---DGFVEFFHVEDLEGG---------
                                                                          

A2BF68_MCL1-02          ---VRNT------LLTIGGVATLSAALA----------YW----------
Q568V1_MCL1-01          ---VRHG------LLALVGCAGIGAGLA----------FL----------
Q1L8X3_MCL1-01          ---VRHG------LLALVGCAGIGAGLA----------FL----------
Q9I9N3_MCL1-01          ---VRHG------LLALVGCAGIGAGLA----------FL----------
W5MMB7_MCL1-01          ---IRNA------LMAFAGVAGLGAGLA----------LL----------
A0A3B3R4U0_MCL1-01      ---VRNA------LVAFAGVASLGAGLA----------LL----------
A0A3B3SG34_MCL1-01      ---VLQK------VLVHVSECGSFELHD----------LKALCM------
A0A3Q2Y539_MCL1-01      ---VRNG------LFAFVGLVSVTAALR----------CL----------
Q4SW32_MCL1-01          ---VRTV------LMAVAGVAGIGAKLA----------LL----------
Q0KFR9_MCL1-01          ---VRNT------LLAFAGVAGIGATLA----------MF----------
A0A3P8Y1W8_MCL1-02      ---------------------PIGLFLQ----------VF----------
A0A3P8Y1W8_MCL1-01      ---VRNT------LMAFAGVAGIGATLA----------LL----------
D2ITA0_MCL1-03          ---VRNT------LMAFAGFAGIGATIA----------LL----------
D2ITA0_MCL1-04          ---VRNT------LMAFAGFAGIGATIA----------LL----------
A0A3P9ILF6_MCL1-02      ---VRNT------LVAFLGIAGVGALLA----------QLNMMAIFKGLP
A0A3P9ILF6_MCL1-01      ---VRNT------LVAFLGIAGVGALLA----------QL----------
A0A3Q2XZL8_MCL1-01      ---VRNT------LMAFAGVAGIGATLA----------LL----------
A0A3B4AFB7_MCL1-02      ---VRNT------LMAVAGLAGIGATLA----------ML----------
A0A3B3VM25_MCL1-01      ---VRNT------LMAFVGVAGIGATLA----------FL----------
I3KXG5_MCL1-01          ---VRNT------LMAFAGFACIGATLA----------LL----------
A0A3Q0R633_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q0R633_MCL1-03      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3B4T8L9_MCL1-02      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3B4T8L9_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q1EQB9_MCL1-02      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3B4ZKP6_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q1BKL8_MCL1-02      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q1EQB9_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q1BKL8_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3P8RQX7_MCL1-02      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3P8RQX7_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
G3PJT0_MCL1-01          ---VRNT------LMAVAGFASIGATLA----------LL----------
A0A3B3IJ04_MCL1-01      ---VRNT------LVAFLGIAGVGALLAQLSR------------------
A0A3P9L1F3_MCL1-01      ---VRNT------LVAFLGIAGVGALLAQLSR------------------
A0A3B3IJ04_MCL1-02      ---VRNT------LVAFLGIAGVGALLAQLNMMAIFKGLP----------
A0A3P9L1F3_MCL1-02      ---VRNT------LVAFLGIAGVGALLAQLNMMAIFKGLP----------
A0A3B3CEX1_MCL1-01      ---VRNT------LVAVLGLAGVGALLAQVQGPYRIWQDM----------
A0A3B3CEX1_MCL1-02      ---VRNT------LVAVLGLAGVGALLAQV--------------------
A0A3Q3VP02_MCL1-01      ---VRNA------LMTIAGVAGIGATLA----------LL----------
A0A3Q3B4P5_MCL1-01      ---VRNT------LMAVAGFAGLGATLA----------LL----------
A0A3Q3B4P5_MCL1-02      ---VRNT------LMAVAGFAGLGATLA----------LL----------
A0A3Q2EDX8_MCL1-01      ---MRNT------LMAFVGVAGIGATLA----------FL----------
A0A3Q2P7X9_MCL1-01      ---VRNT------LMAFVGVAGIGAGLA----------FL----------
A0A3Q2P7X9_MCL1-02      ---VRNT------LMAFVGVAGIGAGLA----------FL----------
A0A3B5PQ55_MCL1-01      ---VRNT------LMAVVGVAGIGATLA----------FL----------
A0A3B5PQ55_MCL1-02      ---VRNT------LMAVVGVAGIGATLA----------FL----------
A0A3P9Q4I8_MCL1-01      ---VRNT------LMAFVGVAGIGATLA----------FL----------
A0A3P9Q4I8_MCL1-02      ---VRNT------LMAFVGVAGIGATLA----------FL----------
A0A087X830_MCL1-01      ---VRNT------LMAFVGVAGIGATLA----------FL----------
A0A3B3YCD0_MCL1-01      ---VRNT------LMAFVGVAGIGATLA----------FL----------
I3JHR5_MCL1-02          ---VRNT------LMAFAGFAGIGATLA----------LL----------
I3JHR5_MCL1-03          ---TREVEWTKGKMFQITLFNSQRSIFAKRCHNKKEKDIF----------
I3JHR5_MCL1-01          ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q4HLQ8_MCL1-01      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A3P8NP63_MCL1-02      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A3Q2VNL8_MCL1-01      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A3P8NP63_MCL1-01      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A3P9BVM3_MCL1-01      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A3B4G4Z6_MCL1-01      ---VRHT------LMAFAGFAGIGATLA----------LL----------
A0A2U9CJ81_MCL1-01      ---MRNT------LIGLAGFAGVGATLA----------LL----------
A0A3P8VKM5_MCL1-03      ---MRNT------LLGLFGVAGLGATLA----------LL----------
A0A3P8VKM5_MCL1-04      ---MRNT------LLGLFGVAGLGATLA----------LL----------
A0A3P8VKM5_MCL1-05      ---MRNT------LLGLFGVAGLGATLA----------LL----------
A0A3Q3IZW0_MCL1-01      ---VRTT------LMAFAGFAGIGATLA----------LL----------
A0A3Q1GX28_MCL1-02      ---VRKS------LMAFAGLAGIGASLA----------LL----------
A0A3Q1GX28_MCL1-01      ---VRKS------LMAFAGLAGIGASLA----------LL----------
A0A3B4XKA5_MCL1-01      ---VRNT------LMAFAGFAGIGATLA----------LL----------
A0A3Q3GP42_MCL1-01      ---VRTT------LMAFAGFAGIGATLA----------LL----------
A0A3Q3M6G2_MCL1-01      ---VRHT------LMAVAGVAGLGATLA----------LL----------
A0A3Q3M6G2_MCL1-02      ---VRHT------LMAVAGVAGLGATLA----------LL----------
A0A3B1IEV7_MCL1-01      ---VRNA------LMAFAGFAGLGAGLA----------LL----------
A0A3B4CGU9_MCL1-03      ---VRNA------LMAFAGFAGLGAGLA----------LL----------
A0A3B4CGU9_MCL1-02      ---VRNA------LMAFAGFAGLGAGLA----------LL----------
A0A3B4AFB7_MCL1-01      ---VRNT------LMAVAGLAGIGATLA----------ML----------
Q8UWD6_MCL1-01          ---VRNT------LLTIGSVATLSAALA----------YW----------
A2BF68_MCL1-01          ---VRNT------LLTIGGVATLSAALA----------YW----------
Q568W5_MCL1-01          ---VRNT------LLTIGGVATLSAALA----------YW----------
A0A3B1K5R1_MCL1-01      ---MRNA------LMAFVTVAGLGASIA----------FL----------
A0A3B4C6H5_MCL1-03      ---MRNA------LMALVTAAGVGAGLV----------LL----------
A0A3B4C6H5_MCL1-01      ---MRNA------LMALVTAAGVGAGLV----------LL----------
A0A3P8V8T6_MCL1-01      ---IRCT------LLGFVGFAGLWATLA----------LL----------
H3AR18_MCL1-01          ---IKNV------LMTFAGVAGLGASLV----------YL----------
G3TVG9_MCL1-01          ---CRNV------QLAFAG-------------------------------
J7H260_MCL1-01          ---LKTV------LMAFAGVAGLGASLA----------YM----------
G1PZ39_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
Q95KR3_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5EPX0_MCL1-02      ---IRNV------LLAFACVAGVGAGLA----------YL----------
A0A2K5EPX0_MCL1-01      ---IRNV------LLAFACVAGVGAGLA----------YL----------
Q9Z1P3_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A5PJR2_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A452GA25_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
G1L3L7_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
G1T2Q0_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F7AVA6_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A337S3J9_MCL1-01      ---DKA--------------------------------------------
A0A337S3J9_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
Q7YRZ9_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F1PAP1_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
Q8HYS5_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
M3XZZ5_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A452RHX5_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
H0XFB7_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F7GTF7_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5CFH3_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------LS----------
A0A2K6V5Y3_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K6KRW9_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5XSB2_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A0D9RZP5_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
I7G687_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5LXU8_MCL1-01      ---IRNV------LLAVAGVAGVGAGLA----------YL----------
A0A2I3GJZ3_MCL1-02      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
H2N5Y9_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2R9BPJ5_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2I3RTV4_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2I2YQH7_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5C7L5_MCL1-01      ---------------------GISNKIA----------L-----------
A0A2K5I9I0_MCL1-02      ---------------------GISNQIA----------LL----------
A0A2K6GI15_MCL1-01      ---------------------GISNKIA----------L-----------
A0A2I3GJZ3_MCL1-01      ---------------------GISNKIA----------LL----------
A0A2K5CFH3_MCL1-03      ---------------------G----------------------------
A0A2K5R5E2_MCL1-03      ---------------------GISNKIA----------L-----------
A0A2K5W0W9_MCL1-01      ---------------------GISNKIA----------LL----------
A0A2K6ECR0_MCL1-02      ---------------------GISNKIA----------LL----------
A0A2I3LFM0_MCL1-01      ---------------------GISNKIA----------LL----------
A0A2K6KRW9_MCL1-02      ---------------------GISNKIA----------LL----------
A0A2K6PPI3_MCL1-02      ---------------------GISNKIA----------LL----------
G3WBC5_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
W5QI41_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F1MQX4_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
B4DLY8_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
B4DG83_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
B4E3L8_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5DMS4_MCL1-01      ---IRNG------LLAFAGVAGVGTDLA----------YL----------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          ---IRNV------LMAFAGVAGLGASLA----------YM----------
K7FPN7_MCL1-01          ---IRNV------LVAFAGFAGLGASLA----------YM----------
H3AR18_MCL1-02          ---IKNV------LMTFAGVAGLGASLV----------YL----------
B6V6J0_MCL1-01          ---LKTV------LMAFSSVAVLGAGLA----------YM----------
H0XHA5_MCL1-01          ---VRNV------LLAFAGVAGVGAGLT----------YL----------
A0A2K6F6N9_MCL1-01      ---IRNV------LLAFAGVAGVGAGLT----------YL----------
G1QAV8_MCL1-01          ---VRNV------LLAFAG-AGVGAGLP----------YL----------
H9GEA6_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          ---IRNV------LVAFASVAGIGAGLA----------YM----------
A0A493U0E8_MCL1-01      ---IRNV------LMAFAGVAGLGASLA----------YM----------
A0A1L1RNM6_MCL1-01      ---IRNV------LMAFAGVAGLGASLA----------YM----------
A0A1L1RNM6_MCL1-02      ---IRNV------LMAFAGVAGLGASLA----------YM----------
G2HFR3_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F6ZMX1_MCL1-01          LLLCAEP------LFWWCQLTASGCHVP----------DK----------
F6ZMX1_MCL1-02          ---N----------------------------------------------
F6ZMX1_MCL1-03          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
G1T2Q0_MCL1-02          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F1PAP1_MCL1-02          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A337S3J9_MCL1-04      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F7AVA6_MCL1-02          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K6GI15_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
C8YZ26_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
F7GTF7_MCL1-02          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5R5E2_MCL1-04      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K6V5Y3_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5LXU8_MCL1-03      ---IRNV------LLAVAGVAGVGAGLA----------YL----------
A0A2K5I9I0_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2I2YQH7_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
Q07820_MCL1-04          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5W0W9_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K6ECR0_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K5XSB2_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2R9BPJ5_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2I3RTV4_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2I3LFM0_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A2K6PPI3_MCL1-03      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A286Y1M5_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
P97287_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A452GA25_MCL1-02      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
G3T756_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A1S3F3I1_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
G1L3L7_MCL1-02          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A287BK44_MCL1-02      ---IRSN------KIAF---------------------------------
A0A287BK44_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
B4DU51_MCL1-01          ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A287DCH9_MCL1-02      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
A0A287DCH9_MCL1-01      ---IRNV------LLAFAGVAGVGAGLA----------YL----------
                                                                          

A2BF68_MCL1-02          -------IR-----------------------------------------
Q568V1_MCL1-01          -------IR-----------------------------------------
Q1L8X3_MCL1-01          -------IR-----------------------------------------
Q9I9N3_MCL1-01          -------IR-----------------------------------------
W5MMB7_MCL1-01          -------IR-----------------------------------------
A0A3B3R4U0_MCL1-01      -------MR-----------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      -------IR-----------------------------------------
Q4SW32_MCL1-01          -------IR-----------------------------------------
Q0KFR9_MCL1-01          -------IR-----------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      -------IR-----------------------------------------
D2ITA0_MCL1-03          -------IR-----------------------------------------
D2ITA0_MCL1-04          -------IR-----------------------------------------
A0A3P9ILF6_MCL1-02      ASARLHNSR-----------------------------------------
A0A3P9ILF6_MCL1-01      -------SR-----------------------------------------
A0A3Q2XZL8_MCL1-01      -------IR-----------------------------------------
A0A3B4AFB7_MCL1-02      -------IR-----------------------------------------
A0A3B3VM25_MCL1-01      -------IRKLRSALGQQKLNTSLLEMRDCTSLEPG--------------
I3KXG5_MCL1-01          -------IR-----------------------------------------
A0A3Q0R633_MCL1-01      -------IR-----------------------------------------
A0A3Q0R633_MCL1-03      -------IR-----------------------------------------
A0A3B4T8L9_MCL1-02      -------IRCLFERSRPKQEGKIAFFPMSCSREAHFHRAHS---------
A0A3B4T8L9_MCL1-01      -------ISAMM--------------------------------------
A0A3Q1EQB9_MCL1-02      -------IRLESKFGETQRTGRGAGGKRWIQGGRRKPQERNRRRHDACRD
A0A3B4ZKP6_MCL1-01      -------IRS----------------------------------------
A0A3Q1BKL8_MCL1-02      -------ISGLAAVGLTQSTENSCKDAHISCCR-----------------
A0A3Q1EQB9_MCL1-01      -------IR-----------------------------------------
A0A3Q1BKL8_MCL1-01      -------IR-----------------------------------------
A0A3P8RQX7_MCL1-02      -------IR-----------------------------------------
A0A3P8RQX7_MCL1-01      -------IR-----------------------------------------
G3PJT0_MCL1-01          -------ISGPSKVQRQLLTIELLQIVRSQRGGHRLQRDVSTRPSPTSGS
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      -------ASTRLHNSR----------------------------------
A0A3P9L1F3_MCL1-02      -------ASARLHNWR----------------------------------
A0A3B3CEX1_MCL1-01      -------TSCHTNLSKNKVGRSPSFAVEGP--------------------
A0A3B3CEX1_MCL1-02      ---------CR---------------------------------------
A0A3Q3VP02_MCL1-01      -------IR-----------------------------------------
A0A3Q3B4P5_MCL1-01      -------ISV----------------------------------------
A0A3Q3B4P5_MCL1-02      -------ISTWSAKCEHRPLENESCVSLAPGIRSCYLSTTTHLSWAAEIW
A0A3Q2EDX8_MCL1-01      -------IR-----------------------------------------
A0A3Q2P7X9_MCL1-01      -------IRNSIKISFIGQDCSWAFTSPPTFPGL----------------
A0A3Q2P7X9_MCL1-02      -------IR-----------------------------------------
A0A3B5PQ55_MCL1-01      -------IRRCKEKY-----------------------------------
A0A3B5PQ55_MCL1-02      -------I-----SF-----------------------------------
A0A3P9Q4I8_MCL1-01      -------ISK----------------------------------------
A0A3P9Q4I8_MCL1-02      -------IR-----------------------------------------
A0A087X830_MCL1-01      -------IR-----------------------------------------
A0A3B3YCD0_MCL1-01      -------IR-----------------------------------------
I3JHR5_MCL1-02          -------IRTNTHSGLRKKWRVSRHGDDPQQASPNLLLWLMLSTTQVTPV
I3JHR5_MCL1-03          -------FPFLLVFF-----------------------------------
I3JHR5_MCL1-01          -------IRFWDALL-----------------------------------
A0A3Q4HLQ8_MCL1-01      -------IR-----------------------------------------
A0A3P8NP63_MCL1-02      -------IRSSTIF------------------------------------
A0A3Q2VNL8_MCL1-01      -------ISGL---------------------------------------
A0A3P8NP63_MCL1-01      -------ISCWDALL-----------------------------------
A0A3P9BVM3_MCL1-01      -------ISCWDALL-----------------------------------
A0A3B4G4Z6_MCL1-01      -------ISCWDALL-----------------------------------
A0A2U9CJ81_MCL1-01      -------IR-----------------------------------------
A0A3P8VKM5_MCL1-03      -------IR-----------------------------------------
A0A3P8VKM5_MCL1-04      -------IR-----------------------------------------
A0A3P8VKM5_MCL1-05      -------IRWK---------------------------------------
A0A3Q3IZW0_MCL1-01      -------IRTNNTCGGLKRKWSRASPW-----------------------
A0A3Q1GX28_MCL1-02      -------ISAVRLQPLHLH-------------------------------
A0A3Q1GX28_MCL1-01      -------ISSCSVM------------------------------------
A0A3B4XKA5_MCL1-01      -------ISAMM--------------------------------------
A0A3Q3GP42_MCL1-01      -------IR-----------------------------------------
A0A3Q3M6G2_MCL1-01      -------ISRNNKMLTSQSAISAPVSA-----------------------
A0A3Q3M6G2_MCL1-02      -------ISYCGVM------------------------------------
A0A3B1IEV7_MCL1-01      -------MR-----------------------------------------
A0A3B4CGU9_MCL1-03      -------MR-----------------------------------------
A0A3B4CGU9_MCL1-02      -------MR-----------------------------------------
A0A3B4AFB7_MCL1-01      -------IR-----------------------------------------
Q8UWD6_MCL1-01          -------IR-----------------------------------------
A2BF68_MCL1-01          -------IR-----------------------------------------
Q568W5_MCL1-01          -------IR-----------------------------------------
A0A3B1K5R1_MCL1-01      -------AR-----------------------------------------
A0A3B4C6H5_MCL1-03      -------SR-----------------------------------------
A0A3B4C6H5_MCL1-01      -------SR-----------------------------------------
A0A3P8V8T6_MCL1-01      -------MRYFLRFVW----------------------------------
H3AR18_MCL1-01          -------MR-----------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -------IR-----------------------------------------
G1PZ39_MCL1-01          -------IR-----------------------------------------
Q95KR3_MCL1-01          -------IR-----------------------------------------
A0A2K5EPX0_MCL1-02      -------IR-----------------------------------------
A0A2K5EPX0_MCL1-01      -------IR-----------------------------------------
Q9Z1P3_MCL1-01          -------IR-----------------------------------------
A5PJR2_MCL1-01          -------IR-----------------------------------------
A0A452GA25_MCL1-01      -------IR-----------------------------------------
G1L3L7_MCL1-01          -------IR-----------------------------------------
G1T2Q0_MCL1-01          -------IR-----------------------------------------
F7AVA6_MCL1-01          -------IR-----------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      -------IR-----------------------------------------
Q7YRZ9_MCL1-01          -------IR-----------------------------------------
F1PAP1_MCL1-01          -------IR-----------------------------------------
Q8HYS5_MCL1-01          -------IR-----------------------------------------
M3XZZ5_MCL1-01          -------IR-----------------------------------------
A0A452RHX5_MCL1-01      -------IR-----------------------------------------
H0XFB7_MCL1-01          -------IR-----------------------------------------
F7GTF7_MCL1-01          -------IR-----------------------------------------
A0A2K5CFH3_MCL1-01      -------LIHI---------------------------------------
A0A2K6V5Y3_MCL1-01      -------IR-----------------------------------------
A0A2K6KRW9_MCL1-01      -------IR-----------------------------------------
A0A2K5XSB2_MCL1-01      -------IR-----------------------------------------
A0A0D9RZP5_MCL1-01      -------IR-----------------------------------------
I7G687_MCL1-01          -------IR-----------------------------------------
A0A2K5LXU8_MCL1-01      -------IR-----------------------------------------
A0A2I3GJZ3_MCL1-02      -------IR-----------------------------------------
H2N5Y9_MCL1-01          -------IR-----------------------------------------
A0A2R9BPJ5_MCL1-01      -------IR-----------------------------------------
A0A2I3RTV4_MCL1-01      -------IR-----------------------------------------
A0A2I2YQH7_MCL1-01      -------IR-----------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          -------IR-----------------------------------------
W5QI41_MCL1-01          -------IR-----------------------------------------
F1MQX4_MCL1-01          -------IR-----------------------------------------
B4DLY8_MCL1-01          -------IR-----------------------------------------
B4DG83_MCL1-01          -------IR-----------------------------------------
B4E3L8_MCL1-01          -------IR-----------------------------------------
A0A2K5DMS4_MCL1-01      -------IR-----------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          -------IR-----------------------------------------
K7FPN7_MCL1-01          -------MR-----------------------------------------
H3AR18_MCL1-02          -------MR-----------------------------------------
B6V6J0_MCL1-01          -------IR-----------------------------------------
H0XHA5_MCL1-01          -------IR-----------------------------------------
A0A2K6F6N9_MCL1-01      -------IR-----------------------------------------
G1QAV8_MCL1-01          -------IR-----------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          -------IR-----------------------------------------
A0A493U0E8_MCL1-01      -------IR-----------------------------------------
A0A1L1RNM6_MCL1-01      -------IRKWRS-------------------------------------
A0A1L1RNM6_MCL1-02      -------IR-----------------------------------------
G2HFR3_MCL1-01          -------IR-----------------------------------------
F6ZMX1_MCL1-01          -------PRNVLTEERKWAASLQRSHNKFSTSMITHGL------------
F6ZMX1_MCL1-02          --------------------------------------------------
F6ZMX1_MCL1-03          -------IR-----------------------------------------
G1T2Q0_MCL1-02          -------IR-----------------------------------------
F1PAP1_MCL1-02          -------IR-----------------------------------------
A0A337S3J9_MCL1-04      -------IR-----------------------------------------
F7AVA6_MCL1-02          -------IR-----------------------------------------
A0A2K6GI15_MCL1-03      -------IR-----------------------------------------
C8YZ26_MCL1-01          -------KR-----------------------------------------
F7GTF7_MCL1-02          -------IR-----------------------------------------
A0A2K5R5E2_MCL1-04      -------IR-----------------------------------------
A0A2K6V5Y3_MCL1-03      -------IR-----------------------------------------
A0A2K5LXU8_MCL1-03      -------IR-----------------------------------------
A0A2K5I9I0_MCL1-03      -------IR-----------------------------------------
A0A2I2YQH7_MCL1-03      -------IR-----------------------------------------
Q07820_MCL1-04          -------IR-----------------------------------------
A0A2K5W0W9_MCL1-03      -------IR-----------------------------------------
A0A2K6ECR0_MCL1-03      -------IR-----------------------------------------
A0A2K5XSB2_MCL1-03      -------IR-----------------------------------------
A0A2R9BPJ5_MCL1-03      -------IR-----------------------------------------
A0A2I3RTV4_MCL1-03      -------IR-----------------------------------------
A0A2I3LFM0_MCL1-03      -------IR-----------------------------------------
A0A2K6PPI3_MCL1-03      -------IR-----------------------------------------
A0A286Y1M5_MCL1-01      -------IR-----------------------------------------
P97287_MCL1-01          -------IR-----------------------------------------
A0A452GA25_MCL1-02      -------IR-----------------------------------------
G3T756_MCL1-01          -------IR-----------------------------------------
A0A1S3F3I1_MCL1-01      -------IR-----------------------------------------
G1L3L7_MCL1-02          -------IR-----------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A287BK44_MCL1-01      -------IR-----------------------------------------
B4DU51_MCL1-01          -------IR-----------------------------------------
A0A287DCH9_MCL1-02      -------IR-----------------------------------------
A0A287DCH9_MCL1-01      -------IR-----------------------------------------
                                                                          

A2BF68_MCL1-02          --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      RGRGQGNRQNWRVPRRGNQEGHGAGRGPRRKQGDRLGRSGPDSGILQERR
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
G3PJT0_MCL1-01          GL------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      -----------------------CWP------------------------
A0A3Q3B4P5_MCL1-02      AAGVDQQDESNLNIGWILPLHNDCWRQAPAPCVSAGKRE-----------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-02          VNCEEHTGRQ----------------------------------------
I3JHR5_MCL1-03          --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
F1PAP1_MCL1-01          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-02          --------------------------------------------------
F6ZMX1_MCL1-03          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-02      --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
A0A1S3F3I1_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
                                                                          

A2BF68_MCL1-02          -------------
Q568V1_MCL1-01          -------------
Q1L8X3_MCL1-01          -------------
Q9I9N3_MCL1-01          -------------
W5MMB7_MCL1-01          -------------
A0A3B3R4U0_MCL1-01      -------------
A0A3B3SG34_MCL1-01      -------------
A0A3Q2Y539_MCL1-01      -------------
Q4SW32_MCL1-01          -------------
Q0KFR9_MCL1-01          -------------
A0A3P8Y1W8_MCL1-02      -------------
A0A3P8Y1W8_MCL1-01      -------------
D2ITA0_MCL1-03          -------------
D2ITA0_MCL1-04          -------------
A0A3P9ILF6_MCL1-02      -------------
A0A3P9ILF6_MCL1-01      -------------
A0A3Q2XZL8_MCL1-01      -------------
A0A3B4AFB7_MCL1-02      -------------
A0A3B3VM25_MCL1-01      -------------
I3KXG5_MCL1-01          -------------
A0A3Q0R633_MCL1-01      -------------
A0A3Q0R633_MCL1-03      -------------
A0A3B4T8L9_MCL1-02      -------------
A0A3B4T8L9_MCL1-01      -------------
A0A3Q1EQB9_MCL1-02      TEKKTLVSEILVT
A0A3B4ZKP6_MCL1-01      -------------
A0A3Q1BKL8_MCL1-02      -------------
A0A3Q1EQB9_MCL1-01      -------------
A0A3Q1BKL8_MCL1-01      -------------
A0A3P8RQX7_MCL1-02      -------------
A0A3P8RQX7_MCL1-01      -------------
G3PJT0_MCL1-01          -------------
A0A3B3IJ04_MCL1-01      -------------
A0A3P9L1F3_MCL1-01      -------------
A0A3B3IJ04_MCL1-02      -------------
A0A3P9L1F3_MCL1-02      -------------
A0A3B3CEX1_MCL1-01      -------------
A0A3B3CEX1_MCL1-02      -------------
A0A3Q3VP02_MCL1-01      -------------
A0A3Q3B4P5_MCL1-01      -------------
A0A3Q3B4P5_MCL1-02      -------------
A0A3Q2EDX8_MCL1-01      -------------
A0A3Q2P7X9_MCL1-01      -------------
A0A3Q2P7X9_MCL1-02      -------------
A0A3B5PQ55_MCL1-01      -------------
A0A3B5PQ55_MCL1-02      -------------
A0A3P9Q4I8_MCL1-01      -------------
A0A3P9Q4I8_MCL1-02      -------------
A0A087X830_MCL1-01      -------------
A0A3B3YCD0_MCL1-01      -------------
I3JHR5_MCL1-02          -------------
I3JHR5_MCL1-03          -------------
I3JHR5_MCL1-01          -------------
A0A3Q4HLQ8_MCL1-01      -------------
A0A3P8NP63_MCL1-02      -------------
A0A3Q2VNL8_MCL1-01      -------------
A0A3P8NP63_MCL1-01      -------------
A0A3P9BVM3_MCL1-01      -------------
A0A3B4G4Z6_MCL1-01      -------------
A0A2U9CJ81_MCL1-01      -------------
A0A3P8VKM5_MCL1-03      -------------
A0A3P8VKM5_MCL1-04      -------------
A0A3P8VKM5_MCL1-05      -------------
A0A3Q3IZW0_MCL1-01      -------------
A0A3Q1GX28_MCL1-02      -------------
A0A3Q1GX28_MCL1-01      -------------
A0A3B4XKA5_MCL1-01      -------------
A0A3Q3GP42_MCL1-01      -------------
A0A3Q3M6G2_MCL1-01      -------------
A0A3Q3M6G2_MCL1-02      -------------
A0A3B1IEV7_MCL1-01      -------------
A0A3B4CGU9_MCL1-03      -------------
A0A3B4CGU9_MCL1-02      -------------
A0A3B4AFB7_MCL1-01      -------------
Q8UWD6_MCL1-01          -------------
A2BF68_MCL1-01          -------------
Q568W5_MCL1-01          -------------
A0A3B1K5R1_MCL1-01      -------------
A0A3B4C6H5_MCL1-03      -------------
A0A3B4C6H5_MCL1-01      -------------
A0A3P8V8T6_MCL1-01      -------------
H3AR18_MCL1-01          -------------
G3TVG9_MCL1-01          -------------
J7H260_MCL1-01          -------------
G1PZ39_MCL1-01          -------------
Q95KR3_MCL1-01          -------------
A0A2K5EPX0_MCL1-02      -------------
A0A2K5EPX0_MCL1-01      -------------
Q9Z1P3_MCL1-01          -------------
A5PJR2_MCL1-01          -------------
A0A452GA25_MCL1-01      -------------
G1L3L7_MCL1-01          -------------
G1T2Q0_MCL1-01          -------------
F7AVA6_MCL1-01          -------------
A0A337S3J9_MCL1-01      -------------
A0A337S3J9_MCL1-03      -------------
Q7YRZ9_MCL1-01          -------------
F1PAP1_MCL1-01          -------------
Q8HYS5_MCL1-01          -------------
M3XZZ5_MCL1-01          -------------
A0A452RHX5_MCL1-01      -------------
H0XFB7_MCL1-01          -------------
F7GTF7_MCL1-01          -------------
A0A2K5CFH3_MCL1-01      -------------
A0A2K6V5Y3_MCL1-01      -------------
A0A2K6KRW9_MCL1-01      -------------
A0A2K5XSB2_MCL1-01      -------------
A0A0D9RZP5_MCL1-01      -------------
I7G687_MCL1-01          -------------
A0A2K5LXU8_MCL1-01      -------------
A0A2I3GJZ3_MCL1-02      -------------
H2N5Y9_MCL1-01          -------------
A0A2R9BPJ5_MCL1-01      -------------
A0A2I3RTV4_MCL1-01      -------------
A0A2I2YQH7_MCL1-01      -------------
A0A2K5C7L5_MCL1-01      -------------
A0A2K5I9I0_MCL1-02      -------------
A0A2K6GI15_MCL1-01      -------------
A0A2I3GJZ3_MCL1-01      -------------
A0A2K5CFH3_MCL1-03      -------------
A0A2K5R5E2_MCL1-03      -------------
A0A2K5W0W9_MCL1-01      -------------
A0A2K6ECR0_MCL1-02      -------------
A0A2I3LFM0_MCL1-01      -------------
A0A2K6KRW9_MCL1-02      -------------
A0A2K6PPI3_MCL1-02      -------------
G3WBC5_MCL1-01          -------------
W5QI41_MCL1-01          -------------
F1MQX4_MCL1-01          -------------
B4DLY8_MCL1-01          -------------
B4DG83_MCL1-01          -------------
B4E3L8_MCL1-01          -------------
A0A2K5DMS4_MCL1-01      -------------
U3KKY6_MCL1-01          -------------
G1MPY7_MCL1-01          -------------
K7FPN7_MCL1-01          -------------
H3AR18_MCL1-02          -------------
B6V6J0_MCL1-01          -------------
H0XHA5_MCL1-01          -------------
A0A2K6F6N9_MCL1-01      -------------
G1QAV8_MCL1-01          -------------
H9GEA6_MCL1-01          -------------
H9GEA6_MCL1-02          -------------
A0A493U0E8_MCL1-01      -------------
A0A1L1RNM6_MCL1-01      -------------
A0A1L1RNM6_MCL1-02      -------------
G2HFR3_MCL1-01          -------------
F6ZMX1_MCL1-01          -------------
F6ZMX1_MCL1-02          -------------
F6ZMX1_MCL1-03          -------------
G1T2Q0_MCL1-02          -------------
F1PAP1_MCL1-02          -------------
A0A337S3J9_MCL1-04      -------------
F7AVA6_MCL1-02          -------------
A0A2K6GI15_MCL1-03      -------------
C8YZ26_MCL1-01          -------------
F7GTF7_MCL1-02          -------------
A0A2K5R5E2_MCL1-04      -------------
A0A2K6V5Y3_MCL1-03      -------------
A0A2K5LXU8_MCL1-03      -------------
A0A2K5I9I0_MCL1-03      -------------
A0A2I2YQH7_MCL1-03      -------------
Q07820_MCL1-04          -------------
A0A2K5W0W9_MCL1-03      -------------
A0A2K6ECR0_MCL1-03      -------------
A0A2K5XSB2_MCL1-03      -------------
A0A2R9BPJ5_MCL1-03      -------------
A0A2I3RTV4_MCL1-03      -------------
A0A2I3LFM0_MCL1-03      -------------
A0A2K6PPI3_MCL1-03      -------------
A0A286Y1M5_MCL1-01      -------------
P97287_MCL1-01          -------------
A0A452GA25_MCL1-02      -------------
G3T756_MCL1-01          -------------
A0A1S3F3I1_MCL1-01      -------------
G1L3L7_MCL1-02          -------------
A0A287BK44_MCL1-02      -------------
A0A287BK44_MCL1-01      -------------
B4DU51_MCL1-01          -------------
A0A287DCH9_MCL1-02      -------------
A0A287DCH9_MCL1-01      -------------
                                     

© 1998-2020Legal notice