Dataset for protein Bcl-w of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------MATPASA--PDTRALVADFVGYKLRQKGYVC
mpslvnspyihvslsslplmgwpnpkypllslspyihaslssltptaar----d-tsvysn-gv-e--ly---g----aq
  larlc lprqhaapqtccla mleflsvgftsssyvpvlcrplilsqkssm-ql e---q-- -  i-  m- rsls-
           a           pssrspgqyqlatsrippp cfa pp   qpp-  sgs       -r   c   f-p
                       knmlh dnppk ppp ffi  kv g     maq  l                     
                       celag ca mh  fd  d    s                                  
                                fd                                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
GAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAE
qta-----pnn--yr---e------s--hqa-ns-ssh--i---t-yr--aeta-s---d-v----v--l---s----v-
-g- td at-es --   -      ah --- --i---i -   - --s ----g-   - a   y-  - a -    - 
e-      -t-   s          -   cn  e vt          ac    c     r -    i             
 p       sq              e                                                      
          c                                                                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     * .*: .   : *   :  *  ::   ..                                         .    
SVNKEMEPLVGQVQeWMVaYLETRLADWIHSSGGWa-EftalygdgalEEArrLrE---------------GNwasV---
-id-- as lpriidyt tlvqsq qrylnhtaspelaaikarvremegg-ek-k-lqnevekqmnmsppp-yagpmims
 --   s     epr g v kdms rg  r n  as --vcss-n--v-al--f-                 - s l   
      q      k    h   gn     q k   - sl-- fs-rp- - l qq                 t p c   
                       i     p i   r g mt  kvant d i                    g d     
                                   n   ln   e  m                                
                                               i                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------RtvltGaValGA----------------------------------------------LvtvgafFask--
ieekmeadaksiyvcnldys-taeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtsvaldesl-rgrqi
l        ---vh verwrl                                              -m-s---d---sg
         s e-a k  v i                                              r-w-hrw kes  
                                                                   arg      cm  
                                                                    l           
                                                                    e           

       330       340       350       360       370       380       390       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                             
-----------------------------------------------------------------------------
kvdfkafiyssltqvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
w svcfplcilys                                                    sg      fl  
   l  i                                                                      
                                                                             
                                                                             
                                                                             
© 1998-2020Legal notice