Dataset for protein Bcl-w of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

81 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02        --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPRPPPPRCPAAPRM
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPL--------------------------IAARM
A0A2K5CWY6_BCL2L2-      ------------HLSSLPL--------------------------IAARM
G3TMU7_BCL2L2-01        --------YIHVSLSSLTL--------------------------AAARM
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      -------------------------------------------------M
A0A2K6TM77_BCL2L2-      -------------------------------------------------M
A0A2K5RUN8_BCL2L2-      -------------------------------------------------M
A0A2K6GWM6_BCL2L2-      -------------------------------------------------M
W5QDH4_BCL2L2-01        -------------------MGWPNLKYLLLGLSPYIHASLLCLTPTAARM
A0A2K6ME72_BCL2L2-      -------------------------------------------------M
A0A2K6RW35_BCL2L2-      -------------------------------------------------M
A0A287ATE4_BCL2L2-      -------------------------------------------------M
A0A2R8M4C0_BCL2L2-      -------------------------------------------------M
A0A452UF16_BCL2L2-      -------------------------------------------------M
A0A2K5MZX9_BCL2L2-      -------------------------------------------------M
A0A2K5HEJ9_BCL2L2-      -------------------------------------------------M
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------M
F7G4L5_BCL2L2-02        -------------------------------------------------M
A0A2K6EA59_BCL2L2-      -------------------------------------------------M
A0A2K6AI25_BCL2L2-      -------------------------------------------------M
A0A1U7RC37_BCL2L2-      -------------------------------------------------M
A0A2I3GEA7_BCL2L2-      -------------------------------------------------M
A0A2R9A2Q3_BCL2L2-      -------------------------------------------------M
H2Q805_BCL2L2-02        -------------------------------------------------M
A0A096NX09_BCL2L2-      -------------------------------------------------M
A0A287ATE4_BCL2L2-      -------------------------------------------------M
A0A4D6NWN1_BCL2L2-      -------------------------------------------------M
A0A1U7UJF2_BCL2L2-      -------------------------------------------------M
A0A452UF16_BCL2L2-      -------------------------------------------------M
G1Q051_BCL2L2-01        -----------------------MNEFSLDNFMLYSFDSVDIRPKVLGPK
G3WPT1_BCL2L2-01        ---------------------------------HSSSPIFFSLPFIASQM
A0A287D9B3_BCL2L2-      -------------------------------------------------M
A0A482LX62_BCL2L2-      -------------------------------------------------M
W5QDH4_BCL2L2-02        -------------------MGWPNLKYLLLGLSPYIHASLLCLTPTAARM
Q7TS60_BCL2L2-01        -----------------------MSLFGLCQYFSYIYVSLSSLPLSAARM
G1LMC3_BCL2L2-01        ---------------------------------PYIHASLSSLTLTAARM
M3Y5X5_BCL2L2-01        -----------------------KPEAPLLAFQPYIHASLSSLTLTAARM
G1P3J2_BCL2L2-01        -----------------------PEMLHSVSLTKYTHASLLSLTFTAARM
G3WPT1_BCL2L2-02        -------------------------------------------------M
G1TV33_BCL2L2-01        -------------------------------------------------M
P70345_BCL2L2-01        -------------------------------------------------M
O88996_BCL2L2-01        -------------------------------------------------M
A0A3Q9B4M8_BCL2L2-      -------------------------------------------------M
H0XR82_BCL2L2-01        -------------------------------------------------M
A0A250YBR2_BCL2L2-      -------------------------------------------------M
A0A250YBR2_BCL2L2-      -------------------------------------------------M
L8HP19_BCL2L2-02        -------------------------------------------------M
L8HP19_BCL2L2-01        -------------------------------------------------M
Q1RMX3_BCL2L2-01        -------------------------------------------------M
A0A452ECF0_BCL2L2-      -------------------------------------------------M
A0A286XQQ9_BCL2L2-      -------------------------------------------------M
A0A2K5RUN8_BCL2L2-      -------------------------------------------------M
A0A2K5MZX9_BCL2L2-      -------------------------------------------------M
A0A0D9RU30_BCL2L2-      -------------------------------------------------M
A0A2K5HEJ9_BCL2L2-      -------------------------------------------------M
A0A1S3FYD8_BCL2L2-      -------------------------------------------------M
A0A2I2UAE3_BCL2L2-      -------------------------------------------------M
A0A2I2YPX6_BCL2L2-      -------------------------------------------------M
A0A287D9B3_BCL2L2-      -------------------------------------------------M
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------M
F7G4L5_BCL2L2-01        -------------------------------------------------M
A0A2K6EA59_BCL2L2-      -------------------------------------------------M
A0A2K6AI25_BCL2L2-      -------------------------------------------------M
A0A1U7RC37_BCL2L2-      -------------------------------------------------M
A0A2I3GEA7_BCL2L2-      -------------------------------------------------M
A0A2R9A2Q3_BCL2L2-      -------------------------------------------------M
H2Q805_BCL2L2-01        -------------------------------------------------M
A0A096NX09_BCL2L2-      -------------------------------------------------M
A0A2K6GWM6_BCL2L2-      -------------------------------------------------M
A0A2K6ME72_BCL2L2-      -------------------------------------------------M
A0A2K6RW35_BCL2L2-      -------------------------------------------------M
A0A2K6RW35_BCL2L2-      -------------------------------------------------M
A0A2K6TM77_BCL2L2-      -------------------------------------------------M
A0A287ATE4_BCL2L2-      -------------------------------------------------M
A0A1U7UJF2_BCL2L2-      -------------------------------------------------M
A0A452SHI1_BCL2L2-      -------------------------------------------------M
Q05KI8_BCL2L2-01        -------------------------------------------------M
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
Q5XGJ4_BCL2L2-01        ---MAQSELGSRALVEDFVRYKLCQRSLVPEPA---GAASCSLHSAMRAA
F7G6M3_BCL2L2-01        ATPAPASVSDTRALVADFVGYKLRQKGFACGAGPGEGPPAQPLHRAMRAA
A0A2K5CWY6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5CWY6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G3TMU7_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
H3AAS7_BCL2L2-02        --MDSL--YSNRGVVEDFIYYKLGQKGYSQQGAPTD-PPANPLYRAMREA
H3AAS7_BCL2L2-01        --MDSL--YSNRGVVEDFIYYKLGQKGYSQQGAPTD-PPANPLYRAMREA
A0A2I2YPX6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6TM77_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5RUN8_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6GWM6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
W5QDH4_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6ME72_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6RW35_BCL2L2-      ATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A287ATE4_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2R8M4C0_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAA
A0A452UF16_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5MZX9_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5HEJ9_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5V0Q3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
F7G4L5_BCL2L2-02        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6EA59_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6AI25_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A1U7RC37_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2I3GEA7_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2R9A2Q3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
H2Q805_BCL2L2-02        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A096NX09_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A287ATE4_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A4D6NWN1_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A1U7UJF2_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A452UF16_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G1Q051_BCL2L2-01        SSQPQA--PDTQALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G3WPT1_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYACGTGPGEGPTNEPLHRAMRAA
A0A287D9B3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A482LX62_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
W5QDH4_BCL2L2-02        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
Q7TS60_BCL2L2-01        ATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G1LMC3_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
M3Y5X5_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G1P3J2_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
G3WPT1_BCL2L2-02        ATPASA--PDTRALVADFVGYKLRQKGYACGTGPGEGPTNEPLHRAMRAA
G1TV33_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAANPLHQAMRAA
P70345_BCL2L2-01        ATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
O88996_BCL2L2-01        ATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A3Q9B4M8_BCL2L2-      ATPASA--PDTRALVADFVGYKMRQKGYVCGAGPGEGPAADPLHQAMRAA
H0XR82_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPATDPLHQAMRAA
A0A250YBR2_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A250YBR2_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
L8HP19_BCL2L2-02        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
L8HP19_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
Q1RMX3_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A452ECF0_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A286XQQ9_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5RUN8_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5MZX9_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A0D9RU30_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5HEJ9_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A1S3FYD8_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2I2UAE3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2I2YPX6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A287D9B3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K5V0Q3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
F7G4L5_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6EA59_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6AI25_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A1U7RC37_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2I3GEA7_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2R9A2Q3_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
H2Q805_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A096NX09_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6GWM6_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6ME72_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6RW35_BCL2L2-      ATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6RW35_BCL2L2-      ATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6TM77_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A287ATE4_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A1U7UJF2_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A452SHI1_BCL2L2-      ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
Q05KI8_BCL2L2-01        ATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
Q5XGJ4_BCL2L2-01        GDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLFQGGVNWGRIVAF
F7G6M3_BCL2L2-01        GDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5CWY6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5CWY6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
G3TMU7_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
H3AAS7_BCL2L2-02        GDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGVNWGRVVAL
H3AAS7_BCL2L2-01        GDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGVNWGRVVAL
A0A2I2YPX6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6TM77_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5RUN8_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6GWM6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
W5QDH4_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6ME72_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A287ATE4_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2R8M4C0_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A452UF16_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5MZX9_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5HEJ9_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5V0Q3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
F7G4L5_BCL2L2-02        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6EA59_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6AI25_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A1U7RC37_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2R9A2Q3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
H2Q805_BCL2L2-02        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A096NX09_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A287ATE4_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A4D6NWN1_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A1U7UJF2_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A452UF16_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
G1Q051_BCL2L2-01        GDEFETHFRCTFSDLVAQLHVTPGSAQQCFTQVSDELFQGGPNWGYLVAF
G3WPT1_BCL2L2-01        GDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGANWGRLVAF
A0A287D9B3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A482LX62_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
W5QDH4_BCL2L2-02        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
Q7TS60_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
G1LMC3_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
M3Y5X5_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
G1P3J2_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
G3WPT1_BCL2L2-02        GDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGANWGRLVAF
G1TV33_BCL2L2-01        GDEFETRFRQNFSDLAAQLHVTPGSAQQSFTQVCDELFQRGPNWGRVVAF
P70345_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
O88996_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A3Q9B4M8_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
H0XR82_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A250YBR2_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A250YBR2_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
L8HP19_BCL2L2-02        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
L8HP19_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
Q1RMX3_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A452ECF0_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A286XQQ9_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5RUN8_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5MZX9_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A0D9RU30_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5HEJ9_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A1S3FYD8_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2I2UAE3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2I2YPX6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A287D9B3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K5V0Q3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
F7G4L5_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6EA59_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6AI25_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A1U7RC37_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2R9A2Q3_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
H2Q805_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A096NX09_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6GWM6_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6ME72_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A2K6TM77_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A287ATE4_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A1U7UJF2_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
A0A452SHI1_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
Q05KI8_BCL2L2-01        GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAF
                                                                          

P70345_BCL2L2-02        ---------------MEPLVGQVQDWMVAYLETRLADWIHSSGGWA-EFT
Q5XGJ4_BCL2L2-01        FVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNGGWN-GFL
F7G6M3_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQDWMVAYLDTQLADWIRSSGGWA-EFT
A0A2K5CWY6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K5CWY6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
G3TMU7_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVVYLETRLADWIHSSGGWA-EFT
H3AAS7_BCL2L2-02        FVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSGGWS-AFV
H3AAS7_BCL2L2-01        FVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSGGWS-AFV
A0A2I2YPX6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6TM77_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K5RUN8_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6GWM6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
W5QDH4_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6ME72_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6RW35_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A287ATE4_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWELEAI
A0A2R8M4C0_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A452UF16_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K5MZX9_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K5HEJ9_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K5V0Q3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
F7G4L5_BCL2L2-02        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6EA59_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2K6AI25_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWELEAI
A0A2I3GEA7_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A2R9A2Q3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
H2Q805_BCL2L2-02        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A096NX09_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A287ATE4_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWELEAI
A0A4D6NWN1_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVTYLESRLADWIHSSGGWELEAI
A0A1U7UJF2_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
A0A452UF16_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAI
G1Q051_BCL2L2-01        FVFGAALCVESVNKEMEPLVGQVQEWTVAYLEMRLADWIHSIGGWA-EFT
G3WPT1_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQEKRYGVHLKQGILARYLPSKAGAA-EFT
A0A287D9B3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----
A0A482LX62_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSASPR-SLM
W5QDH4_BCL2L2-02        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
Q7TS60_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWA-EFT
G1LMC3_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
M3Y5X5_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
G1P3J2_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
G3WPT1_BCL2L2-02        FVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSGGWA-EFT
G1TV33_BCL2L2-01        FAFGAALCAESVNKEMEPLVGQVQEWMVTYLETQLAGWIHSTGGWA-EFT
P70345_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWA-EFT
O88996_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWA-EFT
A0A3Q9B4M8_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVPEWMVTYLETRLADWIHSSGGWA-EFT
H0XR82_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A250YBR2_BCL2L2-      FVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A250YBR2_BCL2L2-      FVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
L8HP19_BCL2L2-02        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
L8HP19_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
Q1RMX3_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A452ECF0_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A286XQQ9_BCL2L2-      FVFGAALCAESVNKEMQPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K5RUN8_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K5MZX9_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A0D9RU30_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K5HEJ9_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A1S3FYD8_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2I2UAE3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2I2YPX6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A287D9B3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K5V0Q3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
F7G4L5_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6EA59_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6AI25_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWA-EFT
A0A2I3GEA7_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2R9A2Q3_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
H2Q805_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A096NX09_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6GWM6_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6ME72_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6RW35_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6RW35_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A2K6TM77_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A287ATE4_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWA-EFT
A0A1U7UJF2_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
A0A452SHI1_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
Q05KI8_BCL2L2-01        FVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFT
                                       * .*: .   : *   :  *  ::   ..      

P70345_BCL2L2-02        ALYGDGALEEARRLRE---------------GNWASV------------R
Q5XGJ4_BCL2L2-01        TLYGDGAIEEARRQRE---------------GNWASL------------K
F7G6M3_BCL2L2-01        ALYGDGALEDARRLRE---------------GNWASV------------R
A0A2K5CWY6_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K5CWY6_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
G3TMU7_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
H3AAS7_BCL2L2-02        CLYGNGAVGGARRFQE---------------GYWSSM------------K
H3AAS7_BCL2L2-01        CLYGNGAVGGARRFQE---------------GYWSSM------------K
A0A2I2YPX6_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6TM77_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K5RUN8_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6GWM6_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
W5QDH4_BCL2L2-01        KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6ME72_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6RW35_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A287ATE4_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2R8M4C0_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A452UF16_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K5MZX9_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K5HEJ9_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K5V0Q3_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
F7G4L5_BCL2L2-02        KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6EA59_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2K6AI25_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A1U7RC37_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADAR
A0A2I3GEA7_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A2R9A2Q3_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
H2Q805_BCL2L2-02        KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A096NX09_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A287ATE4_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A4D6NWN1_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A1U7UJF2_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A452UF16_BCL2L2-      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
G1Q051_BCL2L2-01        ALY----------------------------GNWASV------------R
G3WPT1_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A287D9B3_BCL2L2-      -LFSRGNMGALI-------------------GGWDSC-------------
A0A482LX62_BCL2L2-      NSSKEAPTGAAL---------------------WPSL------------S
W5QDH4_BCL2L2-02        ALYGDGALEEARRLRE---------------GNWASV------------R
Q7TS60_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
G1LMC3_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
M3Y5X5_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
G1P3J2_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
G3WPT1_BCL2L2-02        ALYGDGALEEARRLRE---------------GNWASV------------R
G1TV33_BCL2L2-01        ALYGDRALEEARRLRE---------------GTWASV------------R
P70345_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
O88996_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A3Q9B4M8_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
H0XR82_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A250YBR2_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A250YBR2_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
L8HP19_BCL2L2-02        ALYGDGALEEARRLRE---------------GNWASV------------R
L8HP19_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
Q1RMX3_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A452ECF0_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A286XQQ9_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K5RUN8_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K5MZX9_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A0D9RU30_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K5HEJ9_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A1S3FYD8_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2I2UAE3_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2I2YPX6_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A287D9B3_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K5V0Q3_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
F7G4L5_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6EA59_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6AI25_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A1U7RC37_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2I3GEA7_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2R9A2Q3_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
H2Q805_BCL2L2-01        ALYGDGALEEARRLRE---------------GNWASV------------R
A0A096NX09_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6GWM6_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6ME72_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6RW35_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6RW35_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A2K6TM77_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A287ATE4_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A1U7UJF2_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
A0A452SHI1_BCL2L2-      ALYGDGALEEARRLRE---------------GNWASV------------R
Q05KI8_BCL2L2-01        ALYGVGALEEARRLRE---------------GNWASV------------R
                                                           .              

P70345_BCL2L2-02        TVLTGAVALGA---------------------------------------
Q5XGJ4_BCL2L2-01        TVLTGAVALGA---------------------------------------
F7G6M3_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A2K5CWY6_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K5CWY6_BCL2L2-      TVLTGAVALGA---------------------------------------
G3TMU7_BCL2L2-01        TVLTGAVALGA---------------------------------------
H3AAS7_BCL2L2-02        TVVTGAVALGA---------------------------------------
H3AAS7_BCL2L2-01        TVVTGAVALGA---------------------------------------
A0A2I2YPX6_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6TM77_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K5RUN8_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6GWM6_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
W5QDH4_BCL2L2-01        SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6ME72_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6RW35_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A287ATE4_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2R8M4C0_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A452UF16_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K5MZX9_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K5HEJ9_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K5V0Q3_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
F7G4L5_BCL2L2-02        SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6EA59_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6AI25_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A1U7RC37_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2I3GEA7_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2R9A2Q3_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
H2Q805_BCL2L2-02        SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A096NX09_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A287ATE4_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A4D6NWN1_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A1U7UJF2_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A452UF16_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
G1Q051_BCL2L2-01        TVLTGALALRA---------------------------------------
G3WPT1_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A287D9B3_BCL2L2-      ---AGKEAWG----------------------------------------
A0A482LX62_BCL2L2-      SELHCVLRVSI---------------------------------------
W5QDH4_BCL2L2-02        TVLTGAVALSL---------------------------------------
Q7TS60_BCL2L2-01        TVLTGAVALGA---------------------------------------
G1LMC3_BCL2L2-01        TVLTGAVALGA---------------------------------------
M3Y5X5_BCL2L2-01        TVLTGAVALGA---------------------------------------
G1P3J2_BCL2L2-01        TVLTGAVALGA---------------------------------------
G3WPT1_BCL2L2-02        TVLTGAVALGA---------------------------------------
G1TV33_BCL2L2-01        TVLTGAVALGA---------------------------------------
P70345_BCL2L2-01        TVLTGAVALGA---------------------------------------
O88996_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A3Q9B4M8_BCL2L2-      TVLTGAVALGA---------------------------------------
H0XR82_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A250YBR2_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A250YBR2_BCL2L2-      TVLTGAVALGA---------------------------------------
L8HP19_BCL2L2-02        TVLTGAVALGA---------------------------------------
L8HP19_BCL2L2-01        TVLTGAVALGA---------------------------------------
Q1RMX3_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A452ECF0_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A286XQQ9_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K5RUN8_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K5MZX9_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A0D9RU30_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K5HEJ9_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A1S3FYD8_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2I2UAE3_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2I2YPX6_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A287D9B3_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K5V0Q3_BCL2L2-      TVLTGAVALGA---------------------------------------
F7G4L5_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A2K6EA59_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6AI25_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A1U7RC37_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2I3GEA7_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2R9A2Q3_BCL2L2-      TVLTGAVALGA---------------------------------------
H2Q805_BCL2L2-01        TVLTGAVALGA---------------------------------------
A0A096NX09_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6GWM6_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6ME72_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6RW35_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6RW35_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A2K6TM77_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A287ATE4_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A1U7UJF2_BCL2L2-      TVLTGAVALGA---------------------------------------
A0A452SHI1_BCL2L2-      TVLTGAVALGA---------------------------------------
Q05KI8_BCL2L2-01        TVLTGAVALGA---------------------------------------
                                                                          

P70345_BCL2L2-02        -------LVTVGAFFASK--------------------------------
Q5XGJ4_BCL2L2-01        -------LMTVGALFASK--------------------------------
F7G6M3_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A2K5CWY6_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K5CWY6_BCL2L2-      -------LVTVGAFFASK--------------------------------
G3TMU7_BCL2L2-01        -------LVTVGAFFASK--------------------------------
H3AAS7_BCL2L2-02        -------VMTVGALFASR--------------------------------
H3AAS7_BCL2L2-01        -------VMTVGALFASR--------------------------------
A0A2I2YPX6_BCL2L2-      KESVRTSLALDESLFRGRQIKVDFKAIICSSLTQVIPKRTNRPGISTTDR
A0A2K6TM77_BCL2L2-      KESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDR
A0A2K5RUN8_BCL2L2-      KESVRTSLALDESLFRGRQIKVDVKAFIYSSLTQVIPKRTNRPGISTTDR
A0A2K6GWM6_BCL2L2-      KESVRTSLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTNRPGISTTDR
W5QDH4_BCL2L2-01        KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K6ME72_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K6RW35_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A287ATE4_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2R8M4C0_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A452UF16_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K5MZX9_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K5HEJ9_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K5V0Q3_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
F7G4L5_BCL2L2-02        KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K6EA59_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2K6AI25_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A1U7RC37_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2I3GEA7_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A2R9A2Q3_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
H2Q805_BCL2L2-02        KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A096NX09_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A287ATE4_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A4D6NWN1_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A1U7UJF2_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
A0A452UF16_BCL2L2-      KESVRTSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDR
G1Q051_BCL2L2-01        -------LLTVGAFFASM--------------------------------
G3WPT1_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      -------RRWSHSWDKCRSGW-----------------------------
W5QDH4_BCL2L2-02        -------AEGSGRFFAES--------------------------------
Q7TS60_BCL2L2-01        -------LVTVGAFFASK--------------------------------
G1LMC3_BCL2L2-01        -------LVTVGAFFASK--------------------------------
M3Y5X5_BCL2L2-01        -------LVTVGAFFASK--------------------------------
G1P3J2_BCL2L2-01        -------LVTVGAFFASK--------------------------------
G3WPT1_BCL2L2-02        -------LVTVGAFFASK--------------------------------
G1TV33_BCL2L2-01        -------LVTVGAFFASK--------------------------------
P70345_BCL2L2-01        -------LVTVGAFFASK--------------------------------
O88996_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A3Q9B4M8_BCL2L2-      -------LVTVGAFFASK--------------------------------
H0XR82_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A250YBR2_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A250YBR2_BCL2L2-      -------LVTVGAFFASK--------------------------------
L8HP19_BCL2L2-02        -------LVTVGAFFASK--------------------------------
L8HP19_BCL2L2-01        -------LVTVGAFFASK--------------------------------
Q1RMX3_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A452ECF0_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A286XQQ9_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K5RUN8_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K5MZX9_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A0D9RU30_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K5HEJ9_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A1S3FYD8_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2I2UAE3_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2I2YPX6_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A287D9B3_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K5V0Q3_BCL2L2-      -------LVTVGAFFASK--------------------------------
F7G4L5_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A2K6EA59_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6AI25_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A1U7RC37_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2I3GEA7_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2R9A2Q3_BCL2L2-      -------LVTVGAFFASK--------------------------------
H2Q805_BCL2L2-01        -------LVTVGAFFASK--------------------------------
A0A096NX09_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6GWM6_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6ME72_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6RW35_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6RW35_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A2K6TM77_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A287ATE4_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A1U7UJF2_BCL2L2-      -------LVTVGAFFASK--------------------------------
A0A452SHI1_BCL2L2-      -------LVTVGAFFASK--------------------------------
Q05KI8_BCL2L2-01        -------LVTVGAFFASK--------------------------------
                                                                          

P70345_BCL2L2-02        -----------------------------------------------
Q5XGJ4_BCL2L2-01        -----------------------------------------------
F7G6M3_BCL2L2-01        -----------------------------------------------
A0A2K5CWY6_BCL2L2-      -----------------------------------------------
A0A2K5CWY6_BCL2L2-      -----------------------------------------------
G3TMU7_BCL2L2-01        -----------------------------------------------
H3AAS7_BCL2L2-02        -----------------------------------------------
H3AAS7_BCL2L2-01        -----------------------------------------------
A0A2I2YPX6_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6TM77_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5RUN8_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6GWM6_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
W5QDH4_BCL2L2-01        GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6ME72_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A2K6RW35_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A287ATE4_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A2R8M4C0_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A452UF16_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
A0A2K5MZX9_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5HEJ9_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5V0Q3_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
F7G4L5_BCL2L2-02        GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6EA59_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6AI25_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A1U7RC37_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I3GEA7_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2R9A2Q3_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
H2Q805_BCL2L2-02        GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A096NX09_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A287ATE4_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4D6NWN1_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A1U7UJF2_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A452UF16_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
G1Q051_BCL2L2-01        -----------------------------------------------
G3WPT1_BCL2L2-01        -----------------------------------------------
A0A287D9B3_BCL2L2-      -----------------------------------------------
A0A482LX62_BCL2L2-      -----------------------------------------------
W5QDH4_BCL2L2-02        -----------------------------------------------
Q7TS60_BCL2L2-01        -----------------------------------------------
G1LMC3_BCL2L2-01        -----------------------------------------------
M3Y5X5_BCL2L2-01        -----------------------------------------------
G1P3J2_BCL2L2-01        -----------------------------------------------
G3WPT1_BCL2L2-02        -----------------------------------------------
G1TV33_BCL2L2-01        -----------------------------------------------
P70345_BCL2L2-01        -----------------------------------------------
O88996_BCL2L2-01        -----------------------------------------------
A0A3Q9B4M8_BCL2L2-      -----------------------------------------------
H0XR82_BCL2L2-01        -----------------------------------------------
A0A250YBR2_BCL2L2-      -----------------------------------------------
A0A250YBR2_BCL2L2-      -----------------------------------------------
L8HP19_BCL2L2-02        -----------------------------------------------
L8HP19_BCL2L2-01        -----------------------------------------------
Q1RMX3_BCL2L2-01        -----------------------------------------------
A0A452ECF0_BCL2L2-      -----------------------------------------------
A0A286XQQ9_BCL2L2-      -----------------------------------------------
A0A2K5RUN8_BCL2L2-      -----------------------------------------------
A0A2K5MZX9_BCL2L2-      -----------------------------------------------
A0A0D9RU30_BCL2L2-      -----------------------------------------------
A0A2K5HEJ9_BCL2L2-      -----------------------------------------------
A0A1S3FYD8_BCL2L2-      -----------------------------------------------
A0A2I2UAE3_BCL2L2-      -----------------------------------------------
A0A2I2YPX6_BCL2L2-      -----------------------------------------------
A0A287D9B3_BCL2L2-      -----------------------------------------------
A0A2K5V0Q3_BCL2L2-      -----------------------------------------------
F7G4L5_BCL2L2-01        -----------------------------------------------
A0A2K6EA59_BCL2L2-      -----------------------------------------------
A0A2K6AI25_BCL2L2-      -----------------------------------------------
A0A1U7RC37_BCL2L2-      -----------------------------------------------
A0A2I3GEA7_BCL2L2-      -----------------------------------------------
A0A2R9A2Q3_BCL2L2-      -----------------------------------------------
H2Q805_BCL2L2-01        -----------------------------------------------
A0A096NX09_BCL2L2-      -----------------------------------------------
A0A2K6GWM6_BCL2L2-      -----------------------------------------------
A0A2K6ME72_BCL2L2-      -----------------------------------------------
A0A2K6RW35_BCL2L2-      -----------------------------------------------
A0A2K6RW35_BCL2L2-      -----------------------------------------------
A0A2K6TM77_BCL2L2-      -----------------------------------------------
A0A287ATE4_BCL2L2-      -----------------------------------------------
A0A1U7UJF2_BCL2L2-      -----------------------------------------------
A0A452SHI1_BCL2L2-      -----------------------------------------------
Q05KI8_BCL2L2-01        -----------------------------------------------
                                                                       

© 1998-2020Legal notice