Dataset for protein Bcl-w of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

165 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
G5ASL3_BCL2L2-02        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G5ASL3_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
A0A4X2LP96_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVR
A0A4W2GUJ7_BCL2L2-      MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVR
Q92843_BCL2L2-06        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-05        --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
U3CRF8_BCL2L2-02        --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-03        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-04        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-04        --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
U3CRF8_BCL2L2-01        --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-03        --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-02        --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
G5ASL3_BCL2L2-02        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G5ASL3_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
A0A4X2LP96_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      SPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHHPA
A0A4W2GUJ7_BCL2L2-      SPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHHPA
Q92843_BCL2L2-06        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      -----------------MPLLVLCPYIHASLSSLP---------------
G3TMU7_BCL2L2-01        -------------------------YIHVSLSSLT---------------
A0A2K5CWY6_BCL2L2-      -----------------------------HLSSLP---------------
A0A2K5RUN8_BCL2L2-      -----------------------------HLSSLP---------------
A0A2K6TM77_BCL2L2-      -----------------------------HLSSLP---------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-05        --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
U3CRF8_BCL2L2-02        --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-03        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-04        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-04        --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
U3CRF8_BCL2L2-01        --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-03        --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
Q45T69_BCL2L2-02        --------------------------------------------------
A0A5F5PML6_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        ----------------------------------------------MDSL
H3AAS7_BCL2L2-02        ----------------------------------------------MDSL
Q92843_BCL2L2-01        -------------------------------------------MATPASA
Q92843_BCL2L2-05        -------------------------------------------MATPASA
P70345_BCL2L2-04        -------------------------------------------MATPAST
G1Q051_BCL2L2-01        -----------------MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQA
G3WPT1_BCL2L2-01        ---------------------------HSSSPIFFSLPFIASQMATPASA
P70345_BCL2L2-03        -------------------------------------------MATPAST
Q92843_BCL2L2-04        -------------------------------------------MATPASA
Q92843_BCL2L2-03        -------------------------------------------MATPASA
G5ASL3_BCL2L2-02        -------------------------------------------MATPASA
A0A287D9B3_BCL2L2-      -------------------------------------------MATPASA
A0A482LX62_BCL2L2-      -------------------------------------------MATPASA
W5QDH4_BCL2L2-02        -------------MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASA
Q7TS60_BCL2L2-01        -----------------MSLFGLCQYFSYIYVSLSSLPLSAARMATPAST
G1LMC3_BCL2L2-01        ---------------------------PYIHASLSSLTLTAARMATPASA
M3Y5X5_BCL2L2-01        -----------------KPEAPLLAFQPYIHASLSSLTLTAARMATPASA
G1P3J2_BCL2L2-01        -----------------PEMLHSVSLTKYTHASLLSLTFTAARMATPASA
F7G6M3_BCL2L2-01        -----------------------------------------MATPAPASV
G1TV33_BCL2L2-01        -------------------------------------------MATPASA
P70345_BCL2L2-01        -------------------------------------------MATPAST
O88996_BCL2L2-01        -------------------------------------------MATPAST
A0A3Q9B4M8_BCL2L2-      -------------------------------------------MATPASA
H0XR82_BCL2L2-01        -------------------------------------------MATPASA
Q92843_BCL2L2-02        -------------------------------------------MATPASA
A0A250YBR2_BCL2L2-      -------------------------------------------MATPASA
A0A250YBR2_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
L8HP19_BCL2L2-01        -------------------------------------------MATPASA
L8HP19_BCL2L2-02        -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
Q1RMX3_BCL2L2-01        -------------------------------------------MATPASA
Q45T69_BCL2L2-01        -------------------------------------------MATPASA
A0A452ECF0_BCL2L2-      -------------------------------------------MATPASA
A0A286XQQ9_BCL2L2-      -------------------------------------------MATPASA
A0A2K5RUN8_BCL2L2-      -------------------------------------------MATPASA
A0A2K5MZX9_BCL2L2-      -------------------------------------------MATPASA
A0A0D9RU30_BCL2L2-      -------------------------------------------MATPASA
A0A2K5HEJ9_BCL2L2-      -------------------------------------------MATPASA
G3HRE9_BCL2L2-01        -------------------------------------------MATPASA
A0A1S3FYD8_BCL2L2-      -------------------------------------------MATPASA
A0A2I2UAE3_BCL2L2-      -------------------------------------------MATPASA
A0A2I2YPX6_BCL2L2-      -------------------------------------------MATPASA
G5ASL3_BCL2L2-01        -------------------------------------------MATPASA
A0A287D9B3_BCL2L2-      -------------------------------------------MATPASA
A0A2K5V0Q3_BCL2L2-      -------------------------------------------MATPASA
F7G4L5_BCL2L2-01        -------------------------------------------MATPASA
A0A2K6EA59_BCL2L2-      -------------------------------------------MATPASA
A0A2K6AI25_BCL2L2-      -------------------------------------------MATPASA
A0A1U7RC37_BCL2L2-      -------------------------------------------MATPASA
A0A2I3GEA7_BCL2L2-      -------------------------------------------MATPASA
A0A2R9A2Q3_BCL2L2-      -------------------------------------------MATPASA
H2Q805_BCL2L2-01        -------------------------------------------MATPASA
A0A096NX09_BCL2L2-      -------------------------------------------MATPASA
A0A2K6GWM6_BCL2L2-      -------------------------------------------MATPASA
A0A2K6ME72_BCL2L2-      -------------------------------------------MATPASA
A0A2K6RW35_BCL2L2-      -------------------------------------------MATPASA
A0A2K6RW35_BCL2L2-      -------------------------------------------MATPASA
A0A2K6TM77_BCL2L2-      -------------------------------------------MATPASA
A0A287ATE4_BCL2L2-      -------------------------------------------MATPASA
A0A4X1SF63_BCL2L2-      -------------------------------------------MATPASA
A0A1U7UJF2_BCL2L2-      -------------------------------------------MATPASA
A0A2U4CFE3_BCL2L2-      -------------------------------------------MATPASA
A0A452SHI1_BCL2L2-      -------------------------------------------MATPASA
A0A452UF16_BCL2L2-      -------------------------------------------MATPASA
Q05KI8_BCL2L2-01        -------------------------------------------MATPASA
G3WPT1_BCL2L2-02        -------------------------------------------MATPASA
A0A4X2LP96_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      PGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASA
A0A4W2GUJ7_BCL2L2-      PGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASA
Q92843_BCL2L2-06        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------LIAARMATPASA
G3TMU7_BCL2L2-01        --------------------------------------LAAARMATPASA
A0A2K5CWY6_BCL2L2-      --------------------------------------LIAARMATPASA
A0A2K5RUN8_BCL2L2-      --------------------------------------LIAARMATPASA
A0A2K6TM77_BCL2L2-      --------------------------------------LIAARMATPASA
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      -----------------------------------------------MAA
A0A2K5V0Q3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MAAAAAA
A0A4X1SF63_BCL2L2-      -------------------------------------------MAAAAAA
Q45T69_BCL2L2-05        -------------------------------------------MAAAAAA
A0A5F5PML6_BCL2L2-      -------------------------------------------MAAAAAA
A0A5F8HG85_BCL2L2-      -------------------------------------------MAAAAAA
U3CRF8_BCL2L2-02        -------------------------------------------MAAAAAA
A0A2K5RUN8_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K5MZX9_BCL2L2-      -------------------------------------------MAAAAAA
A0A2I2YPX6_BCL2L2-      -------------------------------------------MAAAAAA
F7G4L5_BCL2L2-03        -------------------------------------------MAAAAAA
A0A2K6EA59_BCL2L2-      -------------------------------------------MAAAAAA
H2Q805_BCL2L2-03        -------------------------------------------MAAAAAA
A0A096NX09_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K6GWM6_BCL2L2-      -------------------------------------------MAAAAAA
A0A287ATE4_BCL2L2-      -------------------------------------------MAAAAAA
A0A287ATE4_BCL2L2-      -------------------------------------------MAAAAAA
A0A4X1SF63_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K5CWY6_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K5RUN8_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K5MZX9_BCL2L2-      -------------------------------------------MAAAAAA
A0A2I2YPX6_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K6EA59_BCL2L2-      -------------------------------------------MAAAAAA
H2Q805_BCL2L2-04        -------------------------------------------MAAAAAA
A0A096NX09_BCL2L2-      -------------------------------------------MAAAAAA
A0A2K6GWM6_BCL2L2-      -------------------------------------------MAAAAAA
Q45T69_BCL2L2-04        -------------------------------------------MAGSLAV
A0A3Q7T511_BCL2L2-      -------------------------------------------MAGSLAV
A0A2I3GEA7_BCL2L2-      -----------------------------------------GLRAVRGSG
A0A2K5CWY6_BCL2L2-      -------------------------------------------MATPASA
A0A2I2YPX6_BCL2L2-      -------------------------------------------MATPASA
A0A2K6TM77_BCL2L2-      -------------------------------------------MATPASA
A0A2K5RUN8_BCL2L2-      -------------------------------------------MATPASA
A0A2K6GWM6_BCL2L2-      -------------------------------------------MATPASA
A0A5F8HG85_BCL2L2-      -------------------------------------------MATPASA
A0A5F8HG85_BCL2L2-      -------------------------------------------MATPASA
W5QDH4_BCL2L2-01        -------------MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A5F5PML6_BCL2L2-      -------------------------------------------MATPASA
U3CRF8_BCL2L2-01        -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A2K6ME72_BCL2L2-      -------------------------------------------MATPASA
A0A2K6RW35_BCL2L2-      -------------------------------------------MATPASA
A0A287ATE4_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
Q45T69_BCL2L2-03        -------------------------------------------MATPASA
A0A2K5MZX9_BCL2L2-      -------------------------------------------MATPASA
A0A2K5HEJ9_BCL2L2-      -------------------------------------------MATPASA
A0A2K5V0Q3_BCL2L2-      -------------------------------------------MATPASA
F7G4L5_BCL2L2-02        -------------------------------------------MATPASA
A0A2K6EA59_BCL2L2-      -------------------------------------------MATPASA
A0A2K6AI25_BCL2L2-      -------------------------------------------MATPASA
A0A1U7RC37_BCL2L2-      -------------------------------------------MATPASA
A0A2I3GEA7_BCL2L2-      -------------------------------------------MATPASA
A0A2R9A2Q3_BCL2L2-      -------------------------------------------MATPASA
H2Q805_BCL2L2-02        -------------------------------------------MATPASA
A0A096NX09_BCL2L2-      -------------------------------------------MATPASA
A0A287ATE4_BCL2L2-      -------------------------------------------MATPASA
A0A4D6NWN1_BCL2L2-      -------------------------------------------MATPASA
A0A4X1SF63_BCL2L2-      -------------------------------------------MATPASA
A0A1U7UJF2_BCL2L2-      -------------------------------------------MATPASA
A0A452UF16_BCL2L2-      -------------------------------------------MATPASA
A0A3Q7T511_BCL2L2-      -------------------------------------------MATPASA
A0A3Q7T511_BCL2L2-      -------------------------------------------MATPASA
A0A4X1SF63_BCL2L2-      -------------------------------------------MATPASA
Q45T69_BCL2L2-02        -------------------------------------------MATPASA
A0A5F5PML6_BCL2L2-      -------------------------------------------MATPASA
A0A452UF16_BCL2L2-      -------------------------------------------MATPASA
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        YSNRGVVEDFIYYKLGQKGYSQQGAPTD-PPA----------------NP
H3AAS7_BCL2L2-02        YSNRGVVEDFIYYKLGQKGYSQQGAPTD-PPA----------------NP
Q92843_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q92843_BCL2L2-05        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
P70345_BCL2L2-04        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G1Q051_BCL2L2-01        PDTQALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G3WPT1_BCL2L2-01        PDTRALVADFVGYKLRQKGYACGTGPGEGPTN----------------EP
P70345_BCL2L2-03        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q92843_BCL2L2-04        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q92843_BCL2L2-03        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G5ASL3_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A287D9B3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A482LX62_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
W5QDH4_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q7TS60_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G1LMC3_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
M3Y5X5_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G1P3J2_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
F7G6M3_BCL2L2-01        SDTRALVADFVGYKLRQKGFACGAGPGEGPPA----------------QP
G1TV33_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------NP
P70345_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
O88996_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A3Q9B4M8_BCL2L2-      PDTRALVADFVGYKMRQKGYVCGAGPGEGPAA----------------DP
H0XR82_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAT----------------DP
Q92843_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A250YBR2_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A250YBR2_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
L8HP19_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
L8HP19_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q1RMX3_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q45T69_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A452ECF0_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A286XQQ9_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5RUN8_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5MZX9_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A0D9RU30_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5HEJ9_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G3HRE9_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A1S3FYD8_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2I2UAE3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2I2YPX6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G5ASL3_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A287D9B3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5V0Q3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
F7G4L5_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6EA59_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6AI25_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A1U7RC37_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2I3GEA7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2R9A2Q3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
H2Q805_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A096NX09_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6GWM6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6ME72_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6RW35_BCL2L2-      PDTRALVADFLGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6RW35_BCL2L2-      PDTRALVADFLGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6TM77_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A287ATE4_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4X1SF63_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A1U7UJF2_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2U4CFE3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A452SHI1_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A452UF16_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q05KI8_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G3WPT1_BCL2L2-02        PDTRALVADFVGYKLRQKGYACGTGPGEGPTN----------------EP
A0A4X2LP96_BCL2L2-      PDTRALVADFVGYKLRQKGYACGTGPGEGPTT----------------EP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q92843_BCL2L2-06        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
G3TMU7_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5CWY6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5RUN8_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6TM77_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGDPGGAGDYGNGLESEELEP
A0A2K5V0Q3_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2D6A3_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2GUJ7_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2D6A3_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2GUJ7_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4X1SF63_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
Q45T69_BCL2L2-05        AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A5F5PML6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A5F8HG85_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEPGEGAPGGAGDYGNGLEAEELEP
U3CRF8_BCL2L2-02        AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K5RUN8_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K5MZX9_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2I2YPX6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
F7G4L5_BCL2L2-03        AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K6EA59_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
H2Q805_BCL2L2-03        AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A096NX09_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K6GWM6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A287ATE4_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A287ATE4_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4X1SF63_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K5CWY6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K5RUN8_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K5MZX9_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2I2YPX6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K6EA59_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
H2Q805_BCL2L2-04        AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A096NX09_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A2K6GWM6_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
Q45T69_BCL2L2-04        RCGARFTC-----------------------------------HETDVSP
A0A3Q7T511_BCL2L2-      RCGARFTC-----------------------------------HETDVSS
A0A2I3GEA7_BCL2L2-      PGRRR--------HLVPRGRWGGRGGGPRGPE----------------EL
A0A2K5CWY6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2I2YPX6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6TM77_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5RUN8_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6GWM6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A5F8HG85_BCL2L2-      PDTRALVADFVGYKLRQKGYACGTGPGEGPTT----------------EP
A0A5F8HG85_BCL2L2-      PDTRALVADFVGYKLRQKGYACGTGPGEGPTT----------------EP
W5QDH4_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A5F5PML6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
U3CRF8_BCL2L2-01        PDTRALVADFVGYKLRQKGYVCGTGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6ME72_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6RW35_BCL2L2-      PDTRALVADFLGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A287ATE4_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q45T69_BCL2L2-03        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5MZX9_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5HEJ9_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K5V0Q3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
F7G4L5_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6EA59_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2K6AI25_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A1U7RC37_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2I3GEA7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A2R9A2Q3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
H2Q805_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A096NX09_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A287ATE4_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4D6NWN1_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4X1SF63_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A1U7UJF2_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A452UF16_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A3Q7T511_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A3Q7T511_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A4X1SF63_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
Q45T69_BCL2L2-02        PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A5F5PML6_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
A0A452UF16_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAGPGEGPAA----------------DP
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        LYRAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADS--LFQD
H3AAS7_BCL2L2-02        LYRAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADS--LFQD
Q92843_BCL2L2-01        LHQAMRAAGD----------------------------------------
Q92843_BCL2L2-05        LHQAMRAAGDEFETRFRRTFSDLAAQLHVT--------------------
P70345_BCL2L2-04        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G1Q051_BCL2L2-01        LHQAMRAAGDEFETHFRCTFSDLVAQLHVTPGSAQQCFTQVSDE--LFQG
G3WPT1_BCL2L2-01        LHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
P70345_BCL2L2-03        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q92843_BCL2L2-04        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q92843_BCL2L2-03        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G5ASL3_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A287D9B3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A482LX62_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
W5QDH4_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q7TS60_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G1LMC3_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
M3Y5X5_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G1P3J2_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
F7G6M3_BCL2L2-01        LHRAMRAAGDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDE--LFQG
G1TV33_BCL2L2-01        LHQAMRAAGDEFETRFRQNFSDLAAQLHVTPGSAQQSFTQVCDE--LFQR
P70345_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
O88996_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A3Q9B4M8_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
H0XR82_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q92843_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A250YBR2_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A250YBR2_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
L8HP19_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
L8HP19_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q1RMX3_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q45T69_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A452ECF0_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A286XQQ9_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5RUN8_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5MZX9_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A0D9RU30_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5HEJ9_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G3HRE9_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A1S3FYD8_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2I2UAE3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2I2YPX6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G5ASL3_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A287D9B3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5V0Q3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
F7G4L5_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6EA59_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6AI25_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A1U7RC37_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2I3GEA7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2R9A2Q3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
H2Q805_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A096NX09_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6GWM6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6ME72_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6RW35_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6RW35_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6TM77_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A287ATE4_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4X1SF63_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A1U7UJF2_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2U4CFE3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A452SHI1_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A452UF16_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q05KI8_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G3WPT1_BCL2L2-02        LHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4X2LP96_BCL2L2-      LHRAMRAAGDEFESRFQRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q92843_BCL2L2-06        ----------------XRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
G3TMU7_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5RUN8_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6TM77_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      GELL----PEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEA
A0A2K5V0Q3_BCL2L2-      EELLLEPEPEPEPEEEPPRPRA----------------------------
A0A4W2D6A3_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGNQEEEEESGLVEG
A0A4W2GUJ7_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGNQEEEEESGLVEG
A0A4W2D6A3_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGNQEEEEESGLVEG
A0A4W2GUJ7_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGNQEEEEESGLVEG
A0A4X1SF63_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
Q45T69_BCL2L2-05        EELLLEPEPEPELEEDPPRAPRLPGSSGPWPGSGAPGSQEEEEEPGLVEG
A0A5F5PML6_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A5F8HG85_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGASGPGPGAGAPGSQEEEEEPGLVEG
U3CRF8_BCL2L2-02        EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2K5RUN8_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2K5MZX9_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2I2YPX6_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
F7G4L5_BCL2L2-03        EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2K6EA59_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
H2Q805_BCL2L2-03        EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A096NX09_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2K6GWM6_BCL2L2-      GELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A287ATE4_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A287ATE4_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A4X1SF63_BCL2L2-      EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEG
A0A2K5CWY6_BCL2L2-      EELLLEPEPE----------------------------PEPEEEPGLVEG
A0A2K5RUN8_BCL2L2-      E--------D----------------------------QEEEEEPGLVEG
A0A2K5MZX9_BCL2L2-      E--------D----------------------------QEEEEEPGLVEG
A0A2I2YPX6_BCL2L2-      E--------D----------------------------QEEEEEPGLVEG
A0A2K6EA59_BCL2L2-      E--------D----------------------------QEEEEEPGLVEG
H2Q805_BCL2L2-04        E--------D----------------------------QEEEEEPGLVEG
A0A096NX09_BCL2L2-      E--------D----------------------------QEEEEEPGLVEG
A0A2K6GWM6_BCL2L2-      G--------D----------------------------QEEEEEPGLVEG
Q45T69_BCL2L2-04        SNLTSQSASE-----------------------RAIAARRSEDWPCLLAL
A0A3Q7T511_BCL2L2-      SNLTSQSASE-----------------------RAIAARRSEDWPFLLAL
A0A2I3GEA7_BCL2L2-      LLEPEPEPEPEEEPPRPRAPPGAPGP---GPGSGAPGSQEEEEEPGLVEG
A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2I2YPX6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6TM77_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5RUN8_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6GWM6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A5F8HG85_BCL2L2-      LHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A5F8HG85_BCL2L2-      LHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
W5QDH4_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A5F5PML6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
U3CRF8_BCL2L2-01        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6ME72_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6RW35_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A287ATE4_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2D6A3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4W2GUJ7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q45T69_BCL2L2-03        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5MZX9_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5HEJ9_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K5V0Q3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
F7G4L5_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6EA59_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2K6AI25_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A1U7RC37_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2I3GEA7_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A2R9A2Q3_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
H2Q805_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A096NX09_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A287ATE4_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4D6NWN1_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4X1SF63_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A1U7UJF2_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A452UF16_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A3Q7T511_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A3Q7T511_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A4X1SF63_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
Q45T69_BCL2L2-02        LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A5F5PML6_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
A0A452UF16_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQG
                                                                          

P70345_BCL2L2-02        -------------------------MEPLVGQVQDWMVAYLETRLADWIH
H3AAS7_BCL2L2-01        GVNWGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWIN
H3AAS7_BCL2L2-02        GVNWGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWIN
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        GPNWGRLVAFFVFGAALCAESVNKEMEP----------------------
G1Q051_BCL2L2-01        GPNWGYLVAFFVFGAALCVESVNKEMEPLVGQVQEWTVAYLEMRLADWIH
G3WPT1_BCL2L2-01        GANWGRLVAFFVFGAALCAESVNKEMEPLVGQEKRYGVHLKQGILARYLP
P70345_BCL2L2-03        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIH
Q92843_BCL2L2-04        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIH
Q92843_BCL2L2-03        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIH
G5ASL3_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A287D9B3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A482LX62_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
W5QDH4_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q7TS60_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIH
G1LMC3_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
M3Y5X5_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
G1P3J2_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
F7G6M3_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLDTQLADWIR
G1TV33_BCL2L2-01        GPNWGRVVAFFAFGAALCAESVNKEMEPLVGQVQEWMVTYLETQLAGWIH
P70345_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIH
O88996_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIH
A0A3Q9B4M8_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVPEWMVTYLETRLADWIH
H0XR82_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q92843_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIH
A0A250YBR2_BCL2L2-      GPNWGRLVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIH
A0A250YBR2_BCL2L2-      GPNWGRLVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
L8HP19_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
L8HP19_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q1RMX3_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q45T69_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A452ECF0_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A286XQQ9_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMQPLVGQVQEWMVAYLETRLADWIH
A0A2K5RUN8_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5MZX9_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A0D9RU30_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5HEJ9_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
G3HRE9_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIH
A0A1S3FYD8_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2I2UAE3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2I2YPX6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
G5ASL3_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A287D9B3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5V0Q3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
F7G4L5_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6EA59_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6AI25_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A1U7RC37_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIH
A0A2I3GEA7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2R9A2Q3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
H2Q805_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A096NX09_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6GWM6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6ME72_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6RW35_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6RW35_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A287ATE4_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
A0A4X1SF63_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
A0A1U7UJF2_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2U4CFE3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A452SHI1_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A452UF16_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q05KI8_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
G3WPT1_BCL2L2-02        GANWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIH
A0A4X2LP96_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q92843_BCL2L2-06        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIH
A0A2K5CWY6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
G3TMU7_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVVYLETRLADWIH
A0A2K5CWY6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5RUN8_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A4W2GUJ7_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A4W2D6A3_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A4W2GUJ7_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A4X1SF63_BCL2L2-      DPGDGA------IEDP----------------------------------
Q45T69_BCL2L2-05        DPGDGA------IEDP----------------------------------
A0A5F5PML6_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A5F8HG85_BCL2L2-      DPGDGA------IEDP----------------------------------
U3CRF8_BCL2L2-02        DPGDGA------IEDP----------------------------------
A0A2K5RUN8_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K5MZX9_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2I2YPX6_BCL2L2-      DPGDGA------IEDP----------------------------------
F7G4L5_BCL2L2-03        DPGDGA------IEDP----------------------------------
A0A2K6EA59_BCL2L2-      DPGDGA------IEDP----------------------------------
H2Q805_BCL2L2-03        DPGDGA------IEDP----------------------------------
A0A096NX09_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K6GWM6_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A287ATE4_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A287ATE4_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A4X1SF63_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K5CWY6_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K5RUN8_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K5MZX9_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2I2YPX6_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K6EA59_BCL2L2-      DPGDGA------IEDP----------------------------------
H2Q805_BCL2L2-04        DPGDGA------IEDP----------------------------------
A0A096NX09_BCL2L2-      DPGDGA------IEDP----------------------------------
A0A2K6GWM6_BCL2L2-      DPGDGA------IEDP----------------------------------
Q45T69_BCL2L2-04        ASGQSPSVIYSRIRLE----------------------------------
A0A3Q7T511_BCL2L2-      ASGQSPSVIYSRIRLE----------------------------------
A0A2I3GEA7_BCL2L2-      DPGDGAIEDP----------------------------------------
A0A2K5CWY6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2I2YPX6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5RUN8_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6GWM6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A5F8HG85_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIH
A0A5F8HG85_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIH
W5QDH4_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A5F5PML6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
U3CRF8_BCL2L2-01        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6ME72_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6RW35_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A287ATE4_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
Q45T69_BCL2L2-03        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5MZX9_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5HEJ9_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K5V0Q3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
F7G4L5_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6EA59_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6AI25_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A1U7RC37_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIH
A0A2I3GEA7_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2R9A2Q3_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
H2Q805_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A096NX09_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A287ATE4_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
A0A4D6NWN1_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLESRLADWIH
A0A4X1SF63_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
A0A1U7UJF2_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A452UF16_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A3Q7T511_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A3Q7T511_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A4X1SF63_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIH
Q45T69_BCL2L2-02        GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A5F5PML6_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A452UF16_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
                                                                          

P70345_BCL2L2-02        SSGGWA-------------------------------EFTALYGDGAL--
H3AAS7_BCL2L2-01        HSGGWS-------------------------------AFVCLYGNGAV--
H3AAS7_BCL2L2-02        HSGGWS-------------------------------AFVCLYGNGAV--
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        SIGGWA-------------------------------EFTALY-------
G3WPT1_BCL2L2-01        SKAGAA-------------------------------EFTALYGDGAL--
P70345_BCL2L2-03        SSGGWV-------------------------------RSSQLLLSASLYK
Q92843_BCL2L2-04        SSGGW---------------------------------------------
Q92843_BCL2L2-03        SSGGWA-------------------------------EF-----------
G5ASL3_BCL2L2-02        SSGGWL-------------------------------IS-----------
A0A287D9B3_BCL2L2-      SSGGWL-------------------------------FS-----------
A0A482LX62_BCL2L2-      SSASPR-------------------------------SLMNSSKEAPT--
W5QDH4_BCL2L2-02        SSGGWA-------------------------------EFTALYGDGAL--
Q7TS60_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
G1LMC3_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
M3Y5X5_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
G1P3J2_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
F7G6M3_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
G1TV33_BCL2L2-01        STGGWA-------------------------------EFTALYGDRAL--
P70345_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
O88996_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A3Q9B4M8_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
H0XR82_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
Q92843_BCL2L2-02        SSGGWA-------------------------------EFTALYGDGAL--
A0A250YBR2_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A250YBR2_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2D6A3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2D6A3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2GUJ7_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
L8HP19_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
L8HP19_BCL2L2-02        SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2D6A3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2D6A3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2GUJ7_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
Q1RMX3_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
Q45T69_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A452ECF0_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A286XQQ9_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K5RUN8_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K5MZX9_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A0D9RU30_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K5HEJ9_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
G3HRE9_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A1S3FYD8_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2I2UAE3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2I2YPX6_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
G5ASL3_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A287D9B3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K5V0Q3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
F7G4L5_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6EA59_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6AI25_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A1U7RC37_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2I3GEA7_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2R9A2Q3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
H2Q805_BCL2L2-01        SSGGWA-------------------------------EFTALYGDGAL--
A0A096NX09_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6GWM6_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6ME72_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6RW35_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6RW35_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2K6TM77_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A287ATE4_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4X1SF63_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A1U7UJF2_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A2U4CFE3_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A452SHI1_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A452UF16_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
Q05KI8_BCL2L2-01        SSGGWA-------------------------------EFTALYGVGAL--
G3WPT1_BCL2L2-02        SSGGWA-------------------------------EFTALYGDGAL--
A0A4X2LP96_BCL2L2-      SSGGWA-------------------------------EFTALYGDGAL--
A0A4W2GUJ7_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
A0A4W2GUJ7_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
Q92843_BCL2L2-06        SSGGWA-------------------------------EFTALYG--DGAL
A0A2K5CWY6_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
G3TMU7_BCL2L2-01        SSGGWA-------------------------------EFTALYG--DGAL
A0A2K5CWY6_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
A0A2K5RUN8_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
A0A2K6TM77_BCL2L2-      SSGGWA-------------------------------EFTALYG--DGAL
A0A2K5HEJ9_BCL2L2-      ------------------------------------------------ME
A0A2K5V0Q3_BCL2L2-      ------------------------------------------------ME
A0A2K6AI25_BCL2L2-      ------------------------------------------------ME
A0A2K6RW35_BCL2L2-      ------------------------------------------------ME
A0A1U7UJF2_BCL2L2-      ------------------------------------------------ME
A0A2R9A2Q3_BCL2L2-      ------------------------------------------------ME
A0A2K6TM77_BCL2L2-      ------------------------------------------------ME
A0A1U7RC37_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5V0Q3_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4W2D6A3_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4W2D6A3_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4X1SF63_BCL2L2-      -------------------------------------ELEAIKARVREME
Q45T69_BCL2L2-05        -------------------------------------ELEAIKARVREME
A0A5F5PML6_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A5F8HG85_BCL2L2-      -------------------------------------ELEAIKARVREME
U3CRF8_BCL2L2-02        -------------------------------------ELEAIKARVREME
A0A2K5RUN8_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5MZX9_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2I2YPX6_BCL2L2-      -------------------------------------ELEAIKARVREME
F7G4L5_BCL2L2-03        -------------------------------------ELEAIKARVREME
A0A2K6EA59_BCL2L2-      -------------------------------------ELEAIKARVREME
H2Q805_BCL2L2-03        -------------------------------------ELEAIKARVREME
A0A096NX09_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K6GWM6_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A287ATE4_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A287ATE4_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4X1SF63_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5CWY6_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5RUN8_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5MZX9_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2I2YPX6_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K6EA59_BCL2L2-      -------------------------------------ELEAIKARVREME
H2Q805_BCL2L2-04        -------------------------------------ELEAIKARVREME
A0A096NX09_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K6GWM6_BCL2L2-      -------------------------------------ELEAIKARVREME
Q45T69_BCL2L2-04        -------------------------------------ELEAIKARVREME
A0A3Q7T511_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2I3GEA7_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A2K5CWY6_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2I2YPX6_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K6TM77_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K5RUN8_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K6GWM6_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A5F8HG85_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A5F8HG85_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
W5QDH4_BCL2L2-01        SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGWFSQTSEAEMVHEVFFGEILSNCDSAPSSPVPEELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGWFSQTSEAEMVHEVFFGEILSNCDSAPSSPVPEELEAIKARVREME
A0A5F5PML6_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
U3CRF8_BCL2L2-01        SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K6ME72_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K6RW35_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A287ATE4_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2D6A3_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2D6A3_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
Q45T69_BCL2L2-03        SSGGW--------------------------------ELEAIKARVREME
A0A2K5MZX9_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K5HEJ9_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K5V0Q3_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
F7G4L5_BCL2L2-02        SSGGW--------------------------------ELEAIKARVREME
A0A2K6EA59_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2K6AI25_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A1U7RC37_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2I3GEA7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A2R9A2Q3_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
H2Q805_BCL2L2-02        SSGGW--------------------------------ELEAIKARVREME
A0A096NX09_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A287ATE4_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4D6NWN1_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4X1SF63_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A1U7UJF2_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A452UF16_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A3Q7T511_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A3Q7T511_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4X1SF63_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
Q45T69_BCL2L2-02        SSGGW--------------------------------ELEAIKARVREME
A0A5F5PML6_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A452UF16_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
                                                                          

P70345_BCL2L2-02        ---EEARRLRE---------------GNWASV------------RTVLTG
H3AAS7_BCL2L2-01        ---GGARRFQE---------------GYWSSM------------KTVVTG
H3AAS7_BCL2L2-02        ---GGARRFQE---------------GYWSSM------------KTVVTG
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------GNWASV------------RTVLTG
G3WPT1_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
P70345_BCL2L2-03        VGLHGKIGPLM---------------GGWGCA------------GKG---
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        ---TA---------------------------------------------
G5ASL3_BCL2L2-02        ---RGKMGALI---------------GGWGSC------------AGKE--
A0A287D9B3_BCL2L2-      ---RGNMGALI---------------GGWDSC------------AGKEAW
A0A482LX62_BCL2L2-      ---GAAL---------------------WPSL------------SSELHC
W5QDH4_BCL2L2-02        ---EEARRLRE---------------GNWASV------------RTVLTG
Q7TS60_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
G1LMC3_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
M3Y5X5_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
G1P3J2_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
F7G6M3_BCL2L2-01        ---EDARRLRE---------------GNWASV------------RTVLTG
G1TV33_BCL2L2-01        ---EEARRLRE---------------GTWASV------------RTVLTG
P70345_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
O88996_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A3Q9B4M8_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
H0XR82_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
Q92843_BCL2L2-02        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A250YBR2_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A250YBR2_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2D6A3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2D6A3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2GUJ7_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
L8HP19_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
L8HP19_BCL2L2-02        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2D6A3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2D6A3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2GUJ7_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
Q1RMX3_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
Q45T69_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A452ECF0_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A286XQQ9_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5RUN8_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5MZX9_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A0D9RU30_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5HEJ9_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
G3HRE9_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A1S3FYD8_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2I2UAE3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2I2YPX6_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
G5ASL3_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A287D9B3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5V0Q3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
F7G4L5_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6EA59_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6AI25_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A1U7RC37_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2I3GEA7_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2R9A2Q3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
H2Q805_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A096NX09_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6GWM6_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6ME72_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6RW35_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6RW35_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6TM77_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A287ATE4_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4X1SF63_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A1U7UJF2_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2U4CFE3_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A452SHI1_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A452UF16_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
Q05KI8_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
G3WPT1_BCL2L2-02        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4X2LP96_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2GUJ7_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A4W2GUJ7_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
Q92843_BCL2L2-06        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5CWY6_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
G3TMU7_BCL2L2-01        ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5CWY6_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5RUN8_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K6TM77_BCL2L2-      ---EEARRLRE---------------GNWASV------------RTVLTG
A0A2K5HEJ9_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5V0Q3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6AI25_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6RW35_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A1U7UJF2_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2R9A2Q3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6TM77_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A1U7RC37_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVG
A0A2K5V0Q3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2D6A3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2D6A3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4X1SF63_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
Q45T69_BCL2L2-05        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F5PML6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F8HG85_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
U3CRF8_BCL2L2-02        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5RUN8_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5MZX9_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2I2YPX6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
F7G4L5_BCL2L2-03        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6EA59_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
H2Q805_BCL2L2-03        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A096NX09_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6GWM6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A287ATE4_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A287ATE4_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4X1SF63_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5CWY6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5RUN8_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5MZX9_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2I2YPX6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6EA59_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
H2Q805_BCL2L2-04        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A096NX09_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6GWM6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
Q45T69_BCL2L2-04        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A3Q7T511_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2I3GEA7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5CWY6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2I2YPX6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6TM77_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5RUN8_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6GWM6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F8HG85_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F8HG85_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
W5QDH4_BCL2L2-01        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F5PML6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
U3CRF8_BCL2L2-01        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6ME72_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6RW35_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A287ATE4_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2D6A3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2D6A3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4W2GUJ7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
Q45T69_BCL2L2-03        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5MZX9_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5HEJ9_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K5V0Q3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
F7G4L5_BCL2L2-02        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6EA59_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6AI25_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A1U7RC37_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVG
A0A2I3GEA7_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2R9A2Q3_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
H2Q805_BCL2L2-02        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A096NX09_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A287ATE4_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4D6NWN1_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4X1SF63_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A1U7UJF2_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A452UF16_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A3Q7T511_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A3Q7T511_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A4X1SF63_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
Q45T69_BCL2L2-02        ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A5F5PML6_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A452UF16_BCL2L2-      ---EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
                                                                          

P70345_BCL2L2-02        AVALGA--------------------------------------------
H3AAS7_BCL2L2-01        AVALGA--------------------------------------------
H3AAS7_BCL2L2-02        AVALGA--------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        ALALRA--------------------------------------------
G3WPT1_BCL2L2-01        AVALGA--------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
G5ASL3_BCL2L2-02        --------------------------------------------------
A0A287D9B3_BCL2L2-      G-------------------------------------------------
A0A482LX62_BCL2L2-      VLRVSI--------------------------------------------
W5QDH4_BCL2L2-02        AVALSL--------------------------------------------
Q7TS60_BCL2L2-01        AVALGA--------------------------------------------
G1LMC3_BCL2L2-01        AVALGA--------------------------------------------
M3Y5X5_BCL2L2-01        AVALGA--------------------------------------------
G1P3J2_BCL2L2-01        AVALGA--------------------------------------------
F7G6M3_BCL2L2-01        AVALGA--------------------------------------------
G1TV33_BCL2L2-01        AVALGA--------------------------------------------
P70345_BCL2L2-01        AVALGA--------------------------------------------
O88996_BCL2L2-01        AVALGA--------------------------------------------
A0A3Q9B4M8_BCL2L2-      AVALGA--------------------------------------------
H0XR82_BCL2L2-01        AVALGA--------------------------------------------
Q92843_BCL2L2-02        AVALGA--------------------------------------------
A0A250YBR2_BCL2L2-      AVALGA--------------------------------------------
A0A250YBR2_BCL2L2-      AVALGA--------------------------------------------
A0A4W2D6A3_BCL2L2-      AVALGA--------------------------------------------
A0A4W2D6A3_BCL2L2-      AVALGA--------------------------------------------
A0A4W2GUJ7_BCL2L2-      AVALGA--------------------------------------------
L8HP19_BCL2L2-01        AVALGA--------------------------------------------
L8HP19_BCL2L2-02        AVALGA--------------------------------------------
A0A4W2D6A3_BCL2L2-      AVALGA--------------------------------------------
A0A4W2D6A3_BCL2L2-      AVALGA--------------------------------------------
A0A4W2GUJ7_BCL2L2-      AVALGA--------------------------------------------
Q1RMX3_BCL2L2-01        AVALGA--------------------------------------------
Q45T69_BCL2L2-01        AVALGA--------------------------------------------
A0A452ECF0_BCL2L2-      AVALGA--------------------------------------------
A0A286XQQ9_BCL2L2-      AVALGA--------------------------------------------
A0A2K5RUN8_BCL2L2-      AVALGA--------------------------------------------
A0A2K5MZX9_BCL2L2-      AVALGA--------------------------------------------
A0A0D9RU30_BCL2L2-      AVALGA--------------------------------------------
A0A2K5HEJ9_BCL2L2-      AVALGA--------------------------------------------
G3HRE9_BCL2L2-01        AVALGA--------------------------------------------
A0A1S3FYD8_BCL2L2-      AVALGA--------------------------------------------
A0A2I2UAE3_BCL2L2-      AVALGA--------------------------------------------
A0A2I2YPX6_BCL2L2-      AVALGA--------------------------------------------
G5ASL3_BCL2L2-01        AVALGA--------------------------------------------
A0A287D9B3_BCL2L2-      AVALGA--------------------------------------------
A0A2K5V0Q3_BCL2L2-      AVALGA--------------------------------------------
F7G4L5_BCL2L2-01        AVALGA--------------------------------------------
A0A2K6EA59_BCL2L2-      AVALGA--------------------------------------------
A0A2K6AI25_BCL2L2-      AVALGA--------------------------------------------
A0A1U7RC37_BCL2L2-      AVALGA--------------------------------------------
A0A2I3GEA7_BCL2L2-      AVALGA--------------------------------------------
A0A2R9A2Q3_BCL2L2-      AVALGA--------------------------------------------
H2Q805_BCL2L2-01        AVALGA--------------------------------------------
A0A096NX09_BCL2L2-      AVALGA--------------------------------------------
A0A2K6GWM6_BCL2L2-      AVALGA--------------------------------------------
A0A2K6ME72_BCL2L2-      AVALGA--------------------------------------------
A0A2K6RW35_BCL2L2-      AVALGA--------------------------------------------
A0A2K6RW35_BCL2L2-      AVALGA--------------------------------------------
A0A2K6TM77_BCL2L2-      AVALGA--------------------------------------------
A0A287ATE4_BCL2L2-      AVALGA--------------------------------------------
A0A4X1SF63_BCL2L2-      AVALGA--------------------------------------------
A0A1U7UJF2_BCL2L2-      AVALGA--------------------------------------------
A0A2U4CFE3_BCL2L2-      AVALGA--------------------------------------------
A0A452SHI1_BCL2L2-      AVALGA--------------------------------------------
A0A452UF16_BCL2L2-      AVALGA--------------------------------------------
Q05KI8_BCL2L2-01        AVALGA--------------------------------------------
G3WPT1_BCL2L2-02        AVALGA--------------------------------------------
A0A4X2LP96_BCL2L2-      AVALGA--------------------------------------------
A0A4W2GUJ7_BCL2L2-      AVALGA--------------------------------------------
A0A4W2GUJ7_BCL2L2-      AVALGA--------------------------------------------
Q92843_BCL2L2-06        AVALGA--------------------------------------------
A0A2K5CWY6_BCL2L2-      AVALGA--------------------------------------------
G3TMU7_BCL2L2-01        AVALGA--------------------------------------------
A0A2K5CWY6_BCL2L2-      AVALGA--------------------------------------------
A0A2K5RUN8_BCL2L2-      AVALGA--------------------------------------------
A0A2K6TM77_BCL2L2-      AVALGA--------------------------------------------
A0A2K5HEJ9_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5V0Q3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6AI25_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6RW35_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A1U7UJF2_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2R9A2Q3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6TM77_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A1U7RC37_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5V0Q3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2D6A3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2D6A3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4X1SF63_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
Q45T69_BCL2L2-05        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A5F5PML6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A5F8HG85_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKDSVR
U3CRF8_BCL2L2-02        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5RUN8_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5MZX9_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2I2YPX6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
F7G4L5_BCL2L2-03        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6EA59_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
H2Q805_BCL2L2-03        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A096NX09_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6GWM6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A287ATE4_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A287ATE4_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4X1SF63_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5CWY6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5RUN8_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5MZX9_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2I2YPX6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6EA59_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
H2Q805_BCL2L2-04        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A096NX09_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6GWM6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
Q45T69_BCL2L2-04        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A3Q7T511_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2I3GEA7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5CWY6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2I2YPX6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6TM77_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5RUN8_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6GWM6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A5F8HG85_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKDSVR
A0A5F8HG85_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKDSVR
W5QDH4_BCL2L2-01        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A5F5PML6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
U3CRF8_BCL2L2-01        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6ME72_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6RW35_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A287ATE4_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2D6A3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2D6A3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4W2GUJ7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
Q45T69_BCL2L2-03        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5MZX9_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5HEJ9_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K5V0Q3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
F7G4L5_BCL2L2-02        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6EA59_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2K6AI25_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A1U7RC37_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2I3GEA7_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A2R9A2Q3_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
H2Q805_BCL2L2-02        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A096NX09_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A287ATE4_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4D6NWN1_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4X1SF63_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A1U7UJF2_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A452UF16_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A3Q7T511_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A3Q7T511_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A4X1SF63_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
Q45T69_BCL2L2-02        NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A5F5PML6_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
A0A452UF16_BCL2L2-      NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR
                                                                          

P70345_BCL2L2-02        --LVTVGAFFASK-------------------------------------
H3AAS7_BCL2L2-01        --VMTVGALFASR-------------------------------------
H3AAS7_BCL2L2-02        --VMTVGALFASR-------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        --LLTVGAFFASM-------------------------------------
G3WPT1_BCL2L2-01        --LVTVGAFFASK-------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
G5ASL3_BCL2L2-02        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --RRWSHSWDKCRSGW----------------------------------
W5QDH4_BCL2L2-02        --AEGSGRFFAES-------------------------------------
Q7TS60_BCL2L2-01        --LVTVGAFFASK-------------------------------------
G1LMC3_BCL2L2-01        --LVTVGAFFASK-------------------------------------
M3Y5X5_BCL2L2-01        --LVTVGAFFASK-------------------------------------
G1P3J2_BCL2L2-01        --LVTVGAFFASK-------------------------------------
F7G6M3_BCL2L2-01        --LVTVGAFFASK-------------------------------------
G1TV33_BCL2L2-01        --LVTVGAFFASK-------------------------------------
P70345_BCL2L2-01        --LVTVGAFFASK-------------------------------------
O88996_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A3Q9B4M8_BCL2L2-      --LVTVGAFFASK-------------------------------------
H0XR82_BCL2L2-01        --LVTVGAFFASK-------------------------------------
Q92843_BCL2L2-02        --LVTVGAFFASK-------------------------------------
A0A250YBR2_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A250YBR2_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2D6A3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2D6A3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2GUJ7_BCL2L2-      --LVTVGAFFASK-------------------------------------
L8HP19_BCL2L2-01        --LVTVGAFFASK-------------------------------------
L8HP19_BCL2L2-02        --LVTVGAFFASK-------------------------------------
A0A4W2D6A3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2D6A3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2GUJ7_BCL2L2-      --LVTVGAFFASK-------------------------------------
Q1RMX3_BCL2L2-01        --LVTVGAFFASK-------------------------------------
Q45T69_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A452ECF0_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A286XQQ9_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5RUN8_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5MZX9_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A0D9RU30_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5HEJ9_BCL2L2-      --LVTVGAFFASK-------------------------------------
G3HRE9_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A1S3FYD8_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2I2UAE3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2I2YPX6_BCL2L2-      --LVTVGAFFASK-------------------------------------
G5ASL3_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A287D9B3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5V0Q3_BCL2L2-      --LVTVGAFFASK-------------------------------------
F7G4L5_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A2K6EA59_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6AI25_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A1U7RC37_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2I3GEA7_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2R9A2Q3_BCL2L2-      --LVTVGAFFASK-------------------------------------
H2Q805_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A096NX09_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6GWM6_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6ME72_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6RW35_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6RW35_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6TM77_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A287ATE4_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4X1SF63_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A1U7UJF2_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2U4CFE3_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A452SHI1_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A452UF16_BCL2L2-      --LVTVGAFFASK-------------------------------------
Q05KI8_BCL2L2-01        --LVTVGAFFASK-------------------------------------
G3WPT1_BCL2L2-02        --LVTVGAFFASK-------------------------------------
A0A4X2LP96_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2GUJ7_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A4W2GUJ7_BCL2L2-      --LVTVGAFFASK-------------------------------------
Q92843_BCL2L2-06        --LVWSTLFTLPSTTG-------------HISLLAFPGTFSQEELQGPWP
A0A2K5CWY6_BCL2L2-      --LVTVGAFFASK-------------------------------------
G3TMU7_BCL2L2-01        --LVTVGAFFASK-------------------------------------
A0A2K5CWY6_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5RUN8_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K6TM77_BCL2L2-      --LVTVGAFFASK-------------------------------------
A0A2K5HEJ9_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5V0Q3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6AI25_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6RW35_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A1U7UJF2_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2R9A2Q3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6TM77_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A1U7RC37_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5V0Q3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2D6A3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2D6A3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4X1SF63_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
Q45T69_BCL2L2-05        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A5F5PML6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A5F8HG85_BCL2L2-      TSMALDDSLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
U3CRF8_BCL2L2-02        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5RUN8_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5MZX9_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2I2YPX6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
F7G4L5_BCL2L2-03        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6EA59_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
H2Q805_BCL2L2-03        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A096NX09_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6GWM6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A287ATE4_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A287ATE4_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4X1SF63_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5CWY6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5RUN8_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5MZX9_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2I2YPX6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6EA59_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
H2Q805_BCL2L2-04        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A096NX09_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6GWM6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
Q45T69_BCL2L2-04        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A3Q7T511_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2I3GEA7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5CWY6_BCL2L2-      TSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRA
A0A2I2YPX6_BCL2L2-      TSLALDESLFRGRQIKVDFKAIICSSLTQVIPKRTNRPGISTTDRGFPRA
A0A2K6TM77_BCL2L2-      TSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRA
A0A2K5RUN8_BCL2L2-      TSLALDESLFRGRQIKVDVKAFIYSSLTQVIPKRTNRPGISTTDRGFPRA
A0A2K6GWM6_BCL2L2-      TSLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTNRPGISTTDRGFPRA
A0A5F8HG85_BCL2L2-      TSMALDDSLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A5F8HG85_BCL2L2-      TSMALDDSLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
W5QDH4_BCL2L2-01        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A5F5PML6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
U3CRF8_BCL2L2-01        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6ME72_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6RW35_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A287ATE4_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2D6A3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2D6A3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4W2GUJ7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
Q45T69_BCL2L2-03        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5MZX9_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5HEJ9_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K5V0Q3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
F7G4L5_BCL2L2-02        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6EA59_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2K6AI25_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A1U7RC37_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2I3GEA7_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A2R9A2Q3_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
H2Q805_BCL2L2-02        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A096NX09_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A287ATE4_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4D6NWN1_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4X1SF63_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A1U7UJF2_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A452UF16_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A3Q7T511_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A3Q7T511_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A4X1SF63_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
Q45T69_BCL2L2-02        TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A5F5PML6_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
A0A452UF16_BCL2L2-      TSLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRA
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
G5ASL3_BCL2L2-02        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G5ASL3_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
A0A4X2LP96_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q92843_BCL2L2-06        GYQNALL-------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5V0Q3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6AI25_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6RW35_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A1U7UJF2_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2R9A2Q3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A2K6TM77_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A1U7RC37_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5V0Q3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2D6A3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4W2D6A3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4X1SF63_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
Q45T69_BCL2L2-05        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A5F5PML6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWRSCLILVNTFP
A0A5F8HG85_BCL2L2-      RYRARATNYSSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
U3CRF8_BCL2L2-02        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5RUN8_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5MZX9_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2I2YPX6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
F7G4L5_BCL2L2-03        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6EA59_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
H2Q805_BCL2L2-03        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A096NX09_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6GWM6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A287ATE4_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A287ATE4_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
A0A4X1SF63_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
A0A2K5CWY6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5RUN8_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5MZX9_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2I2YPX6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6EA59_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
H2Q805_BCL2L2-04        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A096NX09_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6GWM6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
Q45T69_BCL2L2-04        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A3Q7T511_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2I3GEA7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5CWY6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2I2YPX6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6TM77_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5RUN8_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6GWM6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A5F8HG85_BCL2L2-      RYRARATNYSSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
A0A5F8HG85_BCL2L2-      RYRARATNYSSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
W5QDH4_BCL2L2-01        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A5F5PML6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWRSCLILVNTFP
U3CRF8_BCL2L2-01        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A2K6ME72_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A2K6RW35_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A287ATE4_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG------------------
A0A4W2D6A3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2D6A3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4W2GUJ7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
Q45T69_BCL2L2-03        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5MZX9_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5HEJ9_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K5V0Q3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
F7G4L5_BCL2L2-02        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6EA59_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2K6AI25_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A1U7RC37_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2I3GEA7_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A2R9A2Q3_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
H2Q805_BCL2L2-02        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A096NX09_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A287ATE4_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4D6NWN1_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4X1SF63_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A1U7UJF2_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A452UF16_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A3Q7T511_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A3Q7T511_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWYSPY-------
A0A4X1SF63_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRCTSLFATVWRK---------
Q45T69_BCL2L2-02        RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
A0A5F5PML6_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
A0A452UF16_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR-ATSWFL---------
                                                                          

P70345_BCL2L2-02        ----
H3AAS7_BCL2L2-01        ----
H3AAS7_BCL2L2-02        ----
Q92843_BCL2L2-01        ----
Q92843_BCL2L2-05        ----
P70345_BCL2L2-04        ----
G1Q051_BCL2L2-01        ----
G3WPT1_BCL2L2-01        ----
P70345_BCL2L2-03        ----
Q92843_BCL2L2-04        ----
Q92843_BCL2L2-03        ----
G5ASL3_BCL2L2-02        ----
A0A287D9B3_BCL2L2-      ----
A0A482LX62_BCL2L2-      ----
W5QDH4_BCL2L2-02        ----
Q7TS60_BCL2L2-01        ----
G1LMC3_BCL2L2-01        ----
M3Y5X5_BCL2L2-01        ----
G1P3J2_BCL2L2-01        ----
F7G6M3_BCL2L2-01        ----
G1TV33_BCL2L2-01        ----
P70345_BCL2L2-01        ----
O88996_BCL2L2-01        ----
A0A3Q9B4M8_BCL2L2-      ----
H0XR82_BCL2L2-01        ----
Q92843_BCL2L2-02        ----
A0A250YBR2_BCL2L2-      ----
A0A250YBR2_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
L8HP19_BCL2L2-01        ----
L8HP19_BCL2L2-02        ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
Q1RMX3_BCL2L2-01        ----
Q45T69_BCL2L2-01        ----
A0A452ECF0_BCL2L2-      ----
A0A286XQQ9_BCL2L2-      ----
A0A2K5RUN8_BCL2L2-      ----
A0A2K5MZX9_BCL2L2-      ----
A0A0D9RU30_BCL2L2-      ----
A0A2K5HEJ9_BCL2L2-      ----
G3HRE9_BCL2L2-01        ----
A0A1S3FYD8_BCL2L2-      ----
A0A2I2UAE3_BCL2L2-      ----
A0A2I2YPX6_BCL2L2-      ----
G5ASL3_BCL2L2-01        ----
A0A287D9B3_BCL2L2-      ----
A0A2K5V0Q3_BCL2L2-      ----
F7G4L5_BCL2L2-01        ----
A0A2K6EA59_BCL2L2-      ----
A0A2K6AI25_BCL2L2-      ----
A0A1U7RC37_BCL2L2-      ----
A0A2I3GEA7_BCL2L2-      ----
A0A2R9A2Q3_BCL2L2-      ----
H2Q805_BCL2L2-01        ----
A0A096NX09_BCL2L2-      ----
A0A2K6GWM6_BCL2L2-      ----
A0A2K6ME72_BCL2L2-      ----
A0A2K6RW35_BCL2L2-      ----
A0A2K6RW35_BCL2L2-      ----
A0A2K6TM77_BCL2L2-      ----
A0A287ATE4_BCL2L2-      ----
A0A4X1SF63_BCL2L2-      ----
A0A1U7UJF2_BCL2L2-      ----
A0A2U4CFE3_BCL2L2-      ----
A0A452SHI1_BCL2L2-      ----
A0A452UF16_BCL2L2-      ----
Q05KI8_BCL2L2-01        ----
G3WPT1_BCL2L2-02        ----
A0A4X2LP96_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
Q92843_BCL2L2-06        ----
A0A2K5CWY6_BCL2L2-      ----
G3TMU7_BCL2L2-01        ----
A0A2K5CWY6_BCL2L2-      ----
A0A2K5RUN8_BCL2L2-      ----
A0A2K6TM77_BCL2L2-      ----
A0A2K5HEJ9_BCL2L2-      ----
A0A2K5V0Q3_BCL2L2-      ----
A0A2K6AI25_BCL2L2-      ----
A0A2K6RW35_BCL2L2-      ----
A0A1U7UJF2_BCL2L2-      ----
A0A2R9A2Q3_BCL2L2-      ----
A0A2K6TM77_BCL2L2-      ----
A0A1U7RC37_BCL2L2-      ----
A0A2K5V0Q3_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4X1SF63_BCL2L2-      ----
Q45T69_BCL2L2-05        ----
A0A5F5PML6_BCL2L2-      LTLE
A0A5F8HG85_BCL2L2-      ----
U3CRF8_BCL2L2-02        ----
A0A2K5RUN8_BCL2L2-      ----
A0A2K5MZX9_BCL2L2-      ----
A0A2I2YPX6_BCL2L2-      ----
F7G4L5_BCL2L2-03        ----
A0A2K6EA59_BCL2L2-      ----
H2Q805_BCL2L2-03        ----
A0A096NX09_BCL2L2-      ----
A0A2K6GWM6_BCL2L2-      ----
A0A287ATE4_BCL2L2-      ----
A0A287ATE4_BCL2L2-      ----
A0A4X1SF63_BCL2L2-      ----
A0A2K5CWY6_BCL2L2-      ----
A0A2K5RUN8_BCL2L2-      ----
A0A2K5MZX9_BCL2L2-      ----
A0A2I2YPX6_BCL2L2-      ----
A0A2K6EA59_BCL2L2-      ----
H2Q805_BCL2L2-04        ----
A0A096NX09_BCL2L2-      ----
A0A2K6GWM6_BCL2L2-      ----
Q45T69_BCL2L2-04        ----
A0A3Q7T511_BCL2L2-      ----
A0A2I3GEA7_BCL2L2-      ----
A0A2K5CWY6_BCL2L2-      ----
A0A2I2YPX6_BCL2L2-      ----
A0A2K6TM77_BCL2L2-      ----
A0A2K5RUN8_BCL2L2-      ----
A0A2K6GWM6_BCL2L2-      ----
A0A5F8HG85_BCL2L2-      ----
A0A5F8HG85_BCL2L2-      ----
W5QDH4_BCL2L2-01        ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A5F5PML6_BCL2L2-      LTLE
U3CRF8_BCL2L2-01        ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A2K6ME72_BCL2L2-      ----
A0A2K6RW35_BCL2L2-      ----
A0A287ATE4_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
A0A4W2D6A3_BCL2L2-      ----
A0A4W2GUJ7_BCL2L2-      ----
Q45T69_BCL2L2-03        ----
A0A2K5MZX9_BCL2L2-      ----
A0A2K5HEJ9_BCL2L2-      ----
A0A2K5V0Q3_BCL2L2-      ----
F7G4L5_BCL2L2-02        ----
A0A2K6EA59_BCL2L2-      ----
A0A2K6AI25_BCL2L2-      ----
A0A1U7RC37_BCL2L2-      ----
A0A2I3GEA7_BCL2L2-      ----
A0A2R9A2Q3_BCL2L2-      ----
H2Q805_BCL2L2-02        ----
A0A096NX09_BCL2L2-      ----
A0A287ATE4_BCL2L2-      ----
A0A4D6NWN1_BCL2L2-      ----
A0A4X1SF63_BCL2L2-      ----
A0A1U7UJF2_BCL2L2-      ----
A0A452UF16_BCL2L2-      ----
A0A3Q7T511_BCL2L2-      ----
A0A3Q7T511_BCL2L2-      ----
A0A4X1SF63_BCL2L2-      ----
Q45T69_BCL2L2-02        ----
A0A5F5PML6_BCL2L2-      ----
A0A452UF16_BCL2L2-      ----
                            

© 1998-2020Legal notice