Dataset for protein Bcl-xL of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------msssnreLVvdfisy-------
                                                       mtm-mqq-----efylk-       
                                                        een-y-skwkkl--vtf       
                                                           y-rt d  iyh--d       
                                                           ahy     -w  r        
                                                            nn     s   q        
                                                            cc     r   n        
                                                             t     q   m        
                                                             m     a   g        
                                                             l         a        
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------Klsqrnypwsqfsdveenr----rteg-e-e-e-psai-g-pswh-la----vngatggs---
                 ----kg-slnhlgledapnteaaapd-t-s-m-t----n-n---a thdspaa--tfnhtssl
                 rmkc--h-t-liepn-pggsd  --aaggaglgeaqvlreeqrte a-nglv-ss-lvn-rrs
                 mf rtdcc-q-mr--g--- t  da-edkdnaddeglgedsats- ppa hlsrhsv--an n
                  w  nkfnvce-vetvdss    gsnredpsrsadrrdsakrnvs -vv rttdpl-rsr   
                         str -slqtte    tfgwarvdvrmgasv nreaid ssp qgr arssrg   
                         id  kgdasld    ql   qtasvnhnqa  g qpt gt  npg  papcv   
                         c   m rn ia    ed   hire g egt     lr ve       ipc n   
                             l m  d     s    ae y i  mp     an  r       nn      
                             i s             m  g    t      rq  l       gm      
                               p                            g   g       c       
                               a                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                .   :   : :     
-----vip------------------maavkqaLrdaadEFElryrraFsdLtsQLhI--TPgTAYqSFeqVvnElFrDG
sdare---pspprrlqqqlpsttg  lddiretwkesgnrpqrlfaqswnppsnsmdt  hla thhn kn md v kge
rpghpgpsspslgqsasratesas  ae---smilrt-e---kgltlrrrhvhlt av    d v    qs l    q n
wevslttraathqsrsrtphgigd  i-vqqav  --sl   ---ssgvkn vpm       s      ar i    h d
na qssk rreqh qrlsvstgrr  vsp  -l    vr   e  nht p  pv        e       t         
gs pkis qgavl plaecnccsn  -tt  v      -      q w    dt                          
 g e av ed dt e  atqaqpp  tre  g             h       k                          
 t   ra lt gs a  ls  a    p    l             -                                  
     pn    ta     q            t                                                
     mm    a                                                                    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .             *.                    :                       *:     .*         
-VNWGRiValFsFGGaLC----------VEcVdKeMsvLVsR-----IaeWMttYLddhlePWIqe-qGGW---d-----
 i   hvigf a   v s          mdsiern qp  gq     vvs  av  nnqiqd ves n d vr e   c 
         m v   i             k mq d re  a       id   m  ten s   hd h      q     
           t                   av   gq  p       ta   q  e r d   dn        -     
           c                        th  d        t   i      n    g        a     
                                    ns  k                                 v     
                                    ia  c                                 t     
                                    e                                     g     
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
r---Fae-----------------lyGn-----------daAa-------------esRkgqer------fn-r------
t   -vd                 ifsq           ng--             gaqrsr-s      lk k      
c   l-r                 v-er           -tpg             dg-hf-dt      -r -      
h    sn                 fs-k           e- t             qvsg-  n      v- n      
-    c-                 -l h              n             kmn-a  -      is c      
s     k                 m  g                            -l     q       t        
a     q                    -                            ai     a                
                           d                             -     g                
                           v                             y                      
                           s                                                    
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------Wl-------ltg-------------------------mtvagg---vllgslf-------
                    -f       fvt                         valvtv   lvvvvfi       
                     -       iaa                         asmlma   aiasail       
                     m       -l                          lv-fa-   ffilm-v       
                     s        g                          ig --s   ----lv-       
                              -                          gi isi   samtt s       
                                                         --       c  a- m       
                                                                      g         
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600   
....:....|....:....|....:....|....:....|...
                                           
----------ark------------------------------
          sqrrltasv  w                     
          tkqqq                            
          v--h                             
          mvs                              
          -                                
                                           
                                           
                                           
                                           
                                           
                                           
© 1998-2020Legal notice