Dataset for protein Bcl-xL of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

215 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1FR00_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLVFTPERPVDIS
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      GPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFY
R4JQR8_BCL2L1-01        -------------------------------------MNQFSSRYLVADF
A0A346RRN1_BCL2L1-      -------------------------------------MNQYSSRYLVVDF
Q2TAP5_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
Q91828_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------MSQSNRELVVDF
H9GHK7_BCL2L1-01        --------------------------------------MSSSNRALVVDF
Q07816_BCL2L1-04        --------------------------------------MSSSNRELVIDF
A0A493TIA6_BCL2L1-      --------------------------------------MSSGNRELVIDF
Q07816_BCL2L1-03        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-02        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-01        --------------------------------------MSSSNRELVIDF
G1N5N5_BCL2L1-01        --------------------------------------MSSSNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
K7F655_BCL2L1-01        --------------------------------------MSNTNRELVIDF
A0A452E1B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
W5PSA5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-02        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-03        --------------------------------------MSQSNRELVVDF
A0A287CZ07_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A3Q2H0F6_BCL2L1-      --------------------------------------MSQSNRELVVDF
F6WA14_BCL2L1-01        --------------------------------------MSHSNRELVIDF
G3WKX6_BCL2L1-01        --------------------------------------MSHSNRELVVDF
M3XA94_BCL2L1-01        --------------------------------------MSQSNRELVVDF
M3XA94_BCL2L1-02        --------------------------------------MSQSNRELVVDF
H0X6V2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3SPN0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------MSQSNRELVVDF
M3XA94_BCL2L1-03        --------------------------------------MSQSNRELVVDF
G1RER8_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A1S2ZQT6_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-09        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-01        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-01        --------------------------------------MSQSNRELVVDF
O77737_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q9MYW4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A3Q2H0F6_BCL2L1-      --------------------------------------MSQSNRELVVDF
L8J061_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-02        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
E2IV76_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K6G3C5_BCL2L1-      --------------------------------------MSQSNRELVVDF
B2Z3Z4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3HEA7_BCL2L1-02        --------------------------------------MSQSNRELVVDF
G3HEA7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A1U7T4L4_BCL2L1-      --------------------------------------MSQSNRELVVDF
M3Z2H9_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A1U7QU73_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A0D9RJZ8_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A286Y5D6_BCL2L1-      --------------------------------------MSQSNWELVVDF
A0A250YD48_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A1L5BWY3_BCL2L1-      --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-02        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-03        --------------------------------------MSQSNRELVVDF
G1P9D2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5EBP4_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV75_BCL2L1-01        --------------------------------------MSQSNRELVVDF
F7IT34_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q76LT7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5Q6R6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5Q6R6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5M8B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5H963_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q8SQ42_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5VPG2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5YR37_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2R8Z9D7_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A096NV05_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2J8VIH3_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6UWY8_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV77_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A452SDS4_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A384D3U1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FWV3_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q9MZS7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
H3ANS8_BCL2L1-01        --------------------------------------KMSFNRLLVVDH
A0A452FHY1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FHY1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A1S3EPX7_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
H0Z8G3_BCL2L1-01        --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
U3JSL7_BCL2L1-01        --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
Q4U2V6_BCL2L1-01        --------------------------------------MSSSNRELVIDF
D2ITA2_BCL2L1-02        --------------------------------MSIDTSMSISNRELVFFF
A0A3B3E2W4_BCL2L1-      --------------------------------------MSHCNRELVQFY
A0A3B3I2Q5_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3P9I2N4_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3P9MKK4_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3B5B4X7_BCL2L1-      -----------------------------------MEIMSYSNRELVEFF
A0A3B4BFZ8_BCL2L1-      --------------------------------------MSPSNRELVEFF
A0A3Q3FUB6_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B5MGS2_BCL2L1-      --------------------------------------MAYSNRELVEFY
M4A558_BCL2L1-01        --------------------------------------MAYSNRELVEFY
A0A3P9QFB3_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A087YBW4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3VWI7_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3XN57_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2C6K4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2NRP4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A0B4KJI5_BCL2L1-      --------------------------------------MSYSNRELVESF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4V9K8_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4XS24_BCL2L1-      --------------------------------------MSYSNRELVEFF
C1BLI0_BCL2L1-01        --------------------------------------MSYSNRELVVFF
C0HAD8_BCL2L1-01        --------------------------------------MSYSNRELVVFF
A0A3B3ZMX9_BCL2L1-      ---------------------------------------MSLNRELVEFY
A0A3B5K6B9_BCL2L1-      ---------------------------------------MSQNRELVIFY
A0A3B5K6B9_BCL2L1-      ---------------------------------------MSQNRELVIFY
H3CH49_BCL2L1-01        ------------------------RSHPGAKSKGASTQRMSLNRELVIFY
A0A3B3TFR4_BCL2L1-      --------------------------------------MSYSNRELVEYF
A0A3P8XYL5_BCL2L1-      --------------------------------------MTYNNKELVAYY
Q90Z98_BCL2L1-02        --------------------------------------MSYYNRELVVFF
Q90Z98_BCL2L1-01        --------------------------------------MSYYNRELVVFF
A0A059PJI5_BCL2L1-      --------------------------------------MSYYNRELVVYF
A0A3B4DTL9_BCL2L1-      --------------------------------------MSYYNRELVVYF
A0A3Q2FR43_BCL2L1-      ---------------------------------------MSQNRELVLFY
B5XAY3_BCL2L1-01        -------------------------------------MMTYNNRELVVYY
W5MG74_BCL2L1-01        -------------------------------------KMSYSNRDLVVYY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A3Q3B3X5_BCL2L1-      ---------------------------------------MSQNKELVLFY
A0A3B3IB64_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3P9JYH1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3B3DHA1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3Q0RTF8_BCL2L1-      ---------------------------------------MSQNRELVLFY
I3IZK7_BCL2L1-01        -------------------------------------YKMSQNRELVLFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A0D6DR75_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3Q3WIW8_BCL2L1-      ---------------------------------------MSVNRELVAYY
A0A219P0Y3_BCL2L1-      ---------------------------------------MCQNRELVVCY
A0A3Q3MX20_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4V3T1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4XU17_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P9MKK4_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3B3I2Q5_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3P9I2N4_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3B3QRZ2_BCL2L1-      --------------------------------------MSYSNRELVMDF
A0A3B3ZMX9_BCL2L1-      ---------------------------------------MSLNRELVEFY
G3NJY1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A2U9BY16_BCL2L1-      -----------------------------DARQRFCGEHHSRPEWIRQLF
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B1JJ42_BCL2L1-      -------------------------------------VMSYYNRELVVYF
A0A3P8UWG7_BCL2L1-      ------------------------------------TLTFNINRKLVVDY
A0A3Q3IVF5_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1FR00_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
C3VIT1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A3P8P0F1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2X557_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q4N4B5_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B4FNX1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2QPL9_BCL2L1-      ---------------------------------------MSQNRELVLSY
A0A3B5PQJ0_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A087X9B7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3TUS7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3WI27_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3P9N9Y4_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3Q3BEB7_BCL2L1-      --------------------------------------MSHSNRDLVQFY
A0A3P8VMA1_BCL2L1-      --------------------------------------MSCSNRELVKFF
A0A345BSW9_BCL2L1-      --------------------------------------MSYYNRELVVFF
A0A286MU87_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A0F7L1T6_BCL2L1-      --------------------------------------MSYNNRELVEHF
H2U5I3_BCL2L1-01        --------------------------------------MSYNNRELVEHF
H2U5I3_BCL2L1-02        --------------------------------------MSYNNRELVEHF
A0A3Q3J5K3_BCL2L1-      --------------------------------------MSYSHRELVEFY
A0A3Q1EVP6_BCL2L1-      --------------------------------------MSCSNRELVEFF
A0A3Q1BQA0_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3P8U812_BCL2L1-      --------------------------------------MSYSNRELVEFF
E6ZFR0_BCL2L1-01        --------------------------------------MSYSNRELVEFF
G3P7B4_BCL2L1-01        --------------------------------------MANINRELVEFF
A0A3Q3X5M5_BCL2L1-      --------------------------------------MSHSNRELVEFF
A0A2U9BIG9_BCL2L1-      --------------------------------------MSDSNRELVEFF
                                                                          

A0A3Q1FR00_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPN---
R4JQR8_BCL2L1-01        IND------------------------RLRKHGMRWDNCPTLDLPPS---
A0A346RRN1_BCL2L1-      VND------------------------RLRKNGLQWENCPSLEVPPS---
Q2TAP5_BCL2L1-01        VSK------------------------KLSQNEACRKFSNNPQ-------
Q91828_BCL2L1-01        VSK------------------------KLSQNEACRKFSNNPN-------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      LSY------------------------KLSQKGYSWSQFS----------
H9GHK7_BCL2L1-01        LSY------------------------KLSQRGHSWHEIE-----MESGE
Q07816_BCL2L1-04        VSY------------------------KLSQRGHCWSELEEEDENRTD--
A0A493TIA6_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRTELA
Q07816_BCL2L1-03        VSY------------------------KLSQRGHCWSELEEEDENRTDTA
Q07816_BCL2L1-02        VSY------------------------KLSQRGHCWSELEEEDENRTDTA
Q07816_BCL2L1-01        VSY------------------------KLSQRGHCWSELEEEDENRTDTA
G1N5N5_BCL2L1-01        VSY------------------------KLSQKGHCWSELEEEDENRTDTA
A0A452ILL8_BCL2L1-      LSY------------------------KLSQRGYSWSRFEGEDEIRTDSA
A0A452ILL8_BCL2L1-      LSY------------------------KLSQRGYSWSRFEGEDEIRTDSA
K7F655_BCL2L1-01        LSY------------------------KLSQRGHSWSWFEGEDEIRTEAA
A0A452E1B1_BCL2L1-      LSY------------------------KFFQKGYSWSQFSDMEENRTETL
W5PSA5_BCL2L1-01        LSY------------------------KFFQKGYSWSQFSDMEENRTETL
P53563_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
P53563_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A287CZ07_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A3Q2H0F6_BCL2L1-      LSY------------------------KLSQKGYNWSQFSDVEENRTEAP
F6WA14_BCL2L1-01        LSY------------------------KLSQKGYNWSQFED--ENRTEVL
G3WKX6_BCL2L1-01        LSY------------------------KLSQKGYNWSQFED--ENRTEAS
M3XA94_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
M3XA94_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
H0X6V2_BCL2L1-01        ISY------------------------KLSQKGYSWSQFSDVEENRTEAP
G3SPN0_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTGAS
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
M3XA94_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
G1RER8_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A1S2ZQT6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAS
Q64373_BCL2L1-09        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
P53563_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
O77737_BCL2L1-01        LSY------------------------KLSQKGYSWSQFTDVEENRTEAP
Q9MYW4_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A3Q2H0F6_BCL2L1-      LSY------------------------KLSQKGYNWSQFSDVEENRTEAP
L8J061_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q05KJ0_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q05KJ0_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
E2IV76_BCL2L1-01        LSY------------------------KLSQKGYSWSQFIDAEENRTEAP
A0A2K6G3C5_BCL2L1-      LSY------------------------KLSQKGYSWSQFIDAEENRTEAP
B2Z3Z4_BCL2L1-01        LSY------------------------KFSQKGYSWSQFSDVEENRTEAP
G3HEA7_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
G3HEA7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A1U7T4L4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAS
M3Z2H9_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDAEENRTEAP
A0A1U7QU73_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A0D9RJZ8_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A286Y5D6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEGP
A0A250YD48_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A1L5BWY3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
I3MUP5_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
I3MUP5_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
I3MUP5_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
G1P9D2_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5EBP4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
E2IV75_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
F7IT34_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q76LT7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5Q6R6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5Q6R6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5M8B1_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5H963_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q8SQ42_BCL2L1-01        LSY------------------------KLSQKGYSWSRFSDVEENRTEAP
A0A2K5VPG2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K5YR37_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2R8Z9D7_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A096NV05_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2J8VIH3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K6QFA2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K6QFA2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A2K6UWY8_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
E2IV77_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A452SDS4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A384D3U1_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
A0A452FWV3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
Q9MZS7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTEAP
H3ANS8_BCL2L1-01        ISQ------------------------KLMQRGYQWREVG-EQDHGGGGD
A0A452FHY1_BCL2L1-      LSY------------------------KLSQKGFSW-------------S
A0A452FHY1_BCL2L1-      LSY------------------------KLSQKGFSW-------------S
A0A1S3EPX7_BCL2L1-      LSY------------------------KLSQKGYSWSQFS-DVEESRTED
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
H0Z8G3_BCL2L1-01        VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
U3JSL7_BCL2L1-01        VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
Q4U2V6_BCL2L1-01        VSY------------------------KLSQKGYSWSQLE-EEDENRT-D
D2ITA2_BCL2L1-02        LSH------------------------KLSQRNYRPIPFQ-PEGAGE---
A0A3B3E2W4_BCL2L1-      LGY------------------------KMSSRDYPVSLLK-PTDDGG---
A0A3B3I2Q5_BCL2L1-      LAY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3P9I2N4_BCL2L1-      LAY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3P9MKK4_BCL2L1-      LAY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3B5B4X7_BCL2L1-      ISY------------------------KLSQRNYPTSLLR-PEDAAG---
A0A3B4BFZ8_BCL2L1-      ISY------------------------KLSQKNYPSSLLM-SDPARV---
A0A3Q3FUB6_BCL2L1-      ISY------------------------KLSQRNYPTYVLR-SEDAGE---
A0A3B5MGS2_BCL2L1-      ISY------------------------KLSQRNYSSSLLR-SEVAGG---
M4A558_BCL2L1-01        ISY------------------------KLSQRNYSSSLLR-SEVAGG---
A0A3P9QFB3_BCL2L1-      ISY------------------------KLSQRNYSSSLLR-SEADGA---
A0A087YBW4_BCL2L1-      ISY------------------------KLSQRNYSSSLLR-SEADGA---
A0A3B3VWI7_BCL2L1-      ISY------------------------KLSQRNYSSSLLR-SEADGA---
A0A3B3XN57_BCL2L1-      ISY------------------------KLSQRNYSSSLLR-SEADGA---
A0A3Q2C6K4_BCL2L1-      ISY------------------------KLSQTNCPNSLLR-SEVTGG---
A0A3Q2NRP4_BCL2L1-      ISY------------------------KLSQTNCPNSLLR-SEVAGD---
A0A0B4KJI5_BCL2L1-      LSY------------------------KLSQRNYPTALLR-PDDAGG---
A0A3Q1JZ46_BCL2L1-      IMY------------------------KLSQRNHPASLLR-PDDTGG---
A0A3Q1JZ46_BCL2L1-      IMY------------------------KLSQRNHPASLLR-PDDTGG---
A0A3Q3NFM4_BCL2L1-      ISY------------------------KLSQKNYPTSLLR-PEDAGG---
A0A3Q3NFM4_BCL2L1-      ISY------------------------KLSQKNYPTSLLR-PEDAGG---
A0A3B4V9K8_BCL2L1-      ISY------------------------KLSQSNCPTSLLR-PEDAGG---
A0A3B4XS24_BCL2L1-      ISY------------------------KLSQSNCPTSLLR-PEDAGG---
C1BLI0_BCL2L1-01        ISY------------------------KLSQRNYPISQLG-LEDASE---
C0HAD8_BCL2L1-01        ISY------------------------RLSQRNYSCCQLG-LEGASG---
A0A3B3ZMX9_BCL2L1-      IQY------------------------KLSQRDCPLGLED----------
A0A3B5K6B9_BCL2L1-      IKY------------------------KLSQRNYPFNHNGLILEPPS---
A0A3B5K6B9_BCL2L1-      IKY------------------------KLSQRNYPFNHNGLILEPPS---
H3CH49_BCL2L1-01        IKY------------------------KLSQRNYPLSH---IVEPSS---
A0A3B3TFR4_BCL2L1-      VSY------------------------KLAQKNYSIAHII-QDEADE---
A0A3P8XYL5_BCL2L1-      ITY------------------------KLSQRNYPINHTG-LTGAFD---
Q90Z98_BCL2L1-02        IKY------------------------KLSQRNYPCNHIG-LTEDTN---
Q90Z98_BCL2L1-01        IKY------------------------KLSQRNYPCNHIG-LTEDTN---
A0A059PJI5_BCL2L1-      IKY------------------------KLSQKNYPCDHIG-LTEEVN---
A0A3B4DTL9_BCL2L1-      IKY------------------------KLSQRNYPYNHIG-LMEDTN---
A0A3Q2FR43_BCL2L1-      IKF------------------------KLSQRNYPVNHIM-LNEPPN---
B5XAY3_BCL2L1-01        ITY------------------------KLSQRDYPFNHME-LTEAQN---
W5MG74_BCL2L1-01        INY------------------------KLSQKNYSWDQFS-LE---G---
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMG-LNEPPN---
A0A3Q3B3X5_BCL2L1-      IMY------------------------KLSQRNYPVNHII-LSDPPN---
A0A3B3IB64_BCL2L1-      VKY------------------------KLSQRNYPLNHIV-LNESPN---
A0A3P9JYH1_BCL2L1-      VKY------------------------KLSQRNYPLNHIV-LNESPN---
A0A3B3DHA1_BCL2L1-      VKY------------------------KLSQRNYPLNHIV-LNESPN---
A0A3Q0RTF8_BCL2L1-      ITY------------------------KLSQRNYPLNHIV-LNEPSN---
I3IZK7_BCL2L1-01        IRY------------------------KLSQRNYPLNHIV-LNEPLN---
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMG-LNEPPN---
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMG-LNEPPN---
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMG-LNEPPN---
A0A0D6DR75_BCL2L1-      ITY------------------------KLSEKNYPLNHLG-LSEPPN---
A0A3Q3WIW8_BCL2L1-      INY------------------------KLSHRGCPLNHMG-LIEPPN---
A0A219P0Y3_BCL2L1-      IKY------------------------KLTQRNYPLNHMG-LIEPPN---
A0A3Q3MX20_BCL2L1-      IKY------------------------KLSQRNYPLIYIE-LNEQQN---
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHME-LLEPPN---
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHME-LLEPPN---
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHME-LLEPPN---
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLG-LNETPN---
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLG-LNETPN---
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLG-LNETPN---
A0A3B4V3T1_BCL2L1-      IKH------------------------KLSQRNYPLTHME-LNESPN---
A0A3B4XU17_BCL2L1-      IKY------------------------KLSQRNYPLTHME-LNESPN---
A0A3P9MKK4_BCL2L1-      LTY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3B3I2Q5_BCL2L1-      LTY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3P9I2N4_BCL2L1-      LTY------------------------KMSCRDYPVSLLK-PTDDGG---
A0A3B3QRZ2_BCL2L1-      ITY------------------------KLSQRNYN-GHFG-LPEDRG---
A0A3B3ZMX9_BCL2L1-      IQY------------------------KLSQRDCPLQHLG-LGDRST---
G3NJY1_BCL2L1-01        INY------------------------KLSQRNLPLNHIG-LSEPPN---
A0A2U9BY16_BCL2L1-      CRFGFHPQSLLWISADHGCLNRGKQGDSLAQRAFTLT-------------
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIG-LRQALN---
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIG-LRQALN---
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIG-LRQALN---
A0A3B1JJ42_BCL2L1-      IKY------------------------KLSQRNYPTNHIG-LMEETN---
A0A3P8UWG7_BCL2L1-      IQY------------------------KLSQRNFPVHHLG-LGDSPN---
A0A3Q3IVF5_BCL2L1-      ITY------------------------KLSQKNYPLSHLG-LNESPN---
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPS---
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPS---
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPS---
A0A3P8TL99_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPS---
A0A3P8TL99_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPS---
A0A3Q1FR00_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPN---
A0A3B4Z3X2_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPN---
A0A3B4Z3X2_BCL2L1-      IKY------------------------KLSQRNYPLNHMV-LNEAPN---
C3VIT1_BCL2L1-01        IKY------------------------KLSQRNYPLNHIV-LNEPPN---
A0A3P8P0F1_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3Q2X557_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3P9D632_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3P9D632_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3Q4N4B5_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3B4FNX1_BCL2L1-      IRY------------------------KLSQRNYPLNHIV-LNEPSN---
A0A3Q2QPL9_BCL2L1-      VKF------------------------KLSQRNYPVNHIM-LNEPPS---
A0A3B5PQJ0_BCL2L1-      IKF------------------------KLSQRNYPIQHIL-PNEPPD---
A0A087X9B7_BCL2L1-      IKF------------------------KLSQRNYPIQHIL-PNEPPDSTA
A0A3B3TUS7_BCL2L1-      IKF------------------------KLSQRNYPIQHIL-PNEPPDSTA
A0A3B3WI27_BCL2L1-      IKF------------------------KLSQRNYPIQHIL-PNEPPDSTA
A0A3P9N9Y4_BCL2L1-      IKF------------------------KLSQRNYPIQHIL-PNEPPDSTA
A0A3Q3BEB7_BCL2L1-      ISY------------------------KLSQRNCSKSLLM-PEVAGE---
A0A3P8VMA1_BCL2L1-      LGY------------------------KLSQRNYPESLLM-LRIGGE---
A0A345BSW9_BCL2L1-      IKY------------------------KLSQRNYPCNHIG-LTEDTN---
A0A286MU87_BCL2L1-      ISY------------------------RLSQRNYSCCQLG-LEGASG---
A0A3P8XFS0_BCL2L1-      INY------------------------KLSQRNYSCCELE-LEGASG---
A0A3P8XFS0_BCL2L1-      INY------------------------KLSQRNYSCCELE-LEGASG---
A0A0F7L1T6_BCL2L1-      LRY------------------------KLSQRNYPSSLLR-PEDTDG---
H2U5I3_BCL2L1-01        LRY------------------------KLSQRNYPTSLLR-PEDTDG---
H2U5I3_BCL2L1-02        LRY------------------------KLSQRNYPTSLLR-PEDTDG---
A0A3Q3J5K3_BCL2L1-      ISY------------------------KLSQRNYSTSLLR-PENAGG---
A0A3Q1EVP6_BCL2L1-      ISY------------------------KLSQRNYPMSLLR-PEDAGG---
A0A3Q1BQA0_BCL2L1-      VSD------------------------KLSQRNYPTSLLR-PEDAGG---
A0A3P8U812_BCL2L1-      VSY------------------------KLSQRNYPTSLLR-PEDAEG---
E6ZFR0_BCL2L1-01        ISY------------------------KLSQRNHPTSLLR-PENAGE---
G3P7B4_BCL2L1-01        LSY------------------------KLSQKNHPTSLLR-PEDAGG---
A0A3Q3X5M5_BCL2L1-      ISY------------------------KLTQKNYPTSLLR-PEDTGG---
A0A2U9BIG9_BCL2L1-      IGY------------------------KLSQRNYPTSLLR-PEDAGG---
                                                                          

A0A3Q1FR00_BCL2L1-      -RTDGGEARLGEDQRTETH----------ANGTFNGTSPGTPPPSPRRLA
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        -----------------------------PNAISNGTSTSERPGEGATQG
Q91828_BCL2L1-01        -----------------------------PMPYLMEPSTSERPGEGATQG
I7GKS6_BCL2L1-01        --------------------------------------MWKRTGLRPQKG
A0A2K5EBP4_BCL2L1-      --------------------------------------MWKRTGLRPQKG
A0A2K5Q6R6_BCL2L1-      --------------------------------------MWKRTGLRPQKG
A0A2K6UWY8_BCL2L1-      --------------------------------------MWKRTGLRPQKG
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ----VRYG---------------------NPQWISGNPSWHLADSPTVNG
H9GHK7_BCL2L1-01        EAMEPANE---------------------TGNTLNGSPSWHPSPSHVING
Q07816_BCL2L1-04        --TAAEAE---------------------MDSVLNGSPSWHPPAGHVVNG
A0A493TIA6_BCL2L1-      S----EA-----------------------AAVLNGSPSWHPPAGQVVNG
Q07816_BCL2L1-03        A----EAE---------------------MDSVLNGSPSWHPPAGHVVNG
Q07816_BCL2L1-02        A----EAE---------------------MDSVLNGSPSWHPPAGHVVNG
Q07816_BCL2L1-01        A----EAE---------------------MDSVLNGSPSWHPPAGHVVNG
G1N5N5_BCL2L1-01        A----EAE---------------------MDSVLNGSPSWHPPAGHVVNG
A0A452ILL8_BCL2L1-      E----EAE---------------------MASVPNGSPSWHPGASHIVNG
A0A452ILL8_BCL2L1-      E----EAE---------------------MASVPNGSPSWHPGASHIVNG
K7F655_BCL2L1-01        E----EAE---------------------MASVPNGSPSWHPGASHVVNG
A0A452E1B1_BCL2L1-      EGTESDME---------------------TPSAISGNPSWHLADSSVVNG
W5PSA5_BCL2L1-01        EGTESDME---------------------TPSAISGNPSWHLADSPVVNG
P53563_BCL2L1-02        EETEPERE---------------------TPSAINGNPSWHLADSPAVNG
P53563_BCL2L1-03        EETEPERE---------------------TPSAINGNPSWHLADSPAVNG
A0A287CZ07_BCL2L1-      EGTESEVE---------------------TPSAINGNPSWHLADSPAING
A0A3Q2H0F6_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPTGNG
F6WA14_BCL2L1-01        EGA----E---------------------IPSTVNGSPSWHPADSRAVSG
G3WKX6_BCL2L1-01        EGT----E---------------------IPSTVNGSPSWHPADSRAVSG
M3XA94_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
M3XA94_BCL2L1-02        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
H0X6V2_BCL2L1-01        EGNESELE---------------------TPSAINGNPSWHLADSPTVNG
G3SPN0_BCL2L1-01        EGTESEME---------------------IPSAINGNPSRHLADSPAVNG
Q2PFS6_BCL2L1-01        ------ME---------------------TPSAINGNPSWHLVDSPAVNG
O35843_BCL2L1-01        EETEAERE---------------------TPSAINGNPSWHLADSPAVNG
M3XA94_BCL2L1-03        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
G1RER8_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A1S2ZQT6_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPALNG
Q64373_BCL2L1-09        EETEAERE---------------------TPSAINGNPSWHLADSPAVNG
Q64373_BCL2L1-01        EETEAERE---------------------TPSAINGNPSWHLADSPAVNG
P53563_BCL2L1-01        EETEPERE---------------------TPSAINGNPSWHLADSPAVNG
O77737_BCL2L1-01        EGTESEAE---------------------TPSAINGNPSWHLADSPAVNG
Q9MYW4_BCL2L1-01        EGTGPEME---------------------TPSAINGNPAWHPADSPAVNG
A0A3Q2H0F6_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPTGNG
L8J061_BCL2L1-01        EGTESDME---------------------TPSAINGNASWHLADSPAVNG
Q05KJ0_BCL2L1-02        EGTESDME---------------------TPSAINGNASWHLADSPAVNG
Q05KJ0_BCL2L1-01        EGTESDME---------------------TPSAINGNASWHLADSPAVNG
E2IV76_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPPANG
A0A2K6G3C5_BCL2L1-      EATESEME---------------------TPSAINGNPSWHLADSPPANG
B2Z3Z4_BCL2L1-01        EGTESERE---------------------TPSAINGNPSWHLADSPAVNG
G3HEA7_BCL2L1-02        EGTESERE---------------------TPSAINGNPSWHLADSPAVNG
G3HEA7_BCL2L1-01        EGTESERE---------------------TPSAINGNPSWHLADSPAVNG
A0A1U7T4L4_BCL2L1-      EGTESEME---------------------TPSAVNGNPSWHLVDSPAVNG
M3Z2H9_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A1U7QU73_BCL2L1-      EGAESERE---------------------TPSAINGNPSWHLADSPAVNG
A0A0D9RJZ8_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A286Y5D6_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLTDSPTVNG
A0A250YD48_BCL2L1-      EGIESEVE---------------------TPSAINGNPSWHLVDSPAVNG
A0A1L5BWY3_BCL2L1-      EGIESEVE---------------------TPSAINGNPSWHLVDSPAVNG
I3MUP5_BCL2L1-01        EGTESEVE---------------------TPSAINGNPSWHLADSPAVNG
I3MUP5_BCL2L1-02        EGTESEVE---------------------TPSAINGNPSWHLADSPAVNG
I3MUP5_BCL2L1-03        EGTESEVE---------------------TPSAINGNPSWHLADSPAVNG
G1P9D2_BCL2L1-01        EGTESEVE---------------------TPSAINGNPSWHLVDSPAVNG
A0A2K5EBP4_BCL2L1-      EGTDSEME---------------------TPSAINGNPSWHLADSPAVNG
E2IV75_BCL2L1-01        EGTDSEME---------------------TPSAINGNPSWHLADSPAVNG
F7IT34_BCL2L1-01        EGTDSEME---------------------TPSAINGNPSWHLADSPVVNG
Q76LT7_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A2K5Q6R6_BCL2L1-      EGTDSEME---------------------TPSAINGNPSWHLADSPAVNG
A0A2K5Q6R6_BCL2L1-      EGTDSEME---------------------TPSAINGNPSWHLADSPAVNG
A0A2K5M8B1_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2K5H963_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
Q8SQ42_BCL2L1-01        EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A2K5VPG2_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2K5YR37_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2R8Z9D7_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A096NV05_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2J8VIH3_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A2K6QFA2_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2K6QFA2_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLVDSPAVNG
A0A2K6UWY8_BCL2L1-      EGTDSEME---------------------TPSAINGNPAWHLADSPAVNG
E2IV77_BCL2L1-01        EGTDSEME---------------------TPSAINGNPAWHLADSPAVNG
A0A452SDS4_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A384D3U1_BCL2L1-      EGTESEME---------------------TPSAINGNPSWHLADSPAVNG
A0A452FWV3_BCL2L1-      EGTESDME---------------------TPSAINGNPSWHLADSPAVNG
Q9MZS7_BCL2L1-01        EGTESDME---------------------TPSAINGNPSWHLADSPAVNG
H3ANS8_BCL2L1-01        RAREAQTPE--------------------EGAIPGMDPPNG-SHPHAGLN
A0A452FHY1_BCL2L1-      LRRDKIRYG--------------------NPNAVNANPSWH-LAHSPAVN
A0A452FHY1_BCL2L1-      LRRDKIRYG--------------------NPNAVNANPSWH-LAHSPAVN
A0A1S3EPX7_BCL2L1-      PEGTESEME--------------------TPSAINGNPSWHLADSPAVVN
A0A218USB3_BCL2L1-      FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
H0Z8G3_BCL2L1-01        FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
A0A218USB3_BCL2L1-      FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
U3JSL7_BCL2L1-01        FAGEEDEMD----------------------GVLNGSPSWH-APTSHIVN
A0A218USB3_BCL2L1-      FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
A0A218USB3_BCL2L1-      FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
Q4U2V6_BCL2L1-01        FAGEEDEMD----------------------GVLNGSPSWH-AATSHIVN
D2ITA2_BCL2L1-02        -GTDEDKSNRI------------------GNNGLRLNDGNG-NGQLAPSP
A0A3B3E2W4_BCL2L1-      -QTAEDR---------------SAT----CNGTLVNS---E-DGQLKKSC
A0A3B3I2Q5_BCL2L1-      -ETEEDH---------------SDA----RNRRLVSS---E-DGRLRRSC
A0A3P9I2N4_BCL2L1-      -ETEEDH---------------SAA----RNGRQVSS---E-DGQLRRSC
A0A3P9MKK4_BCL2L1-      -ETEEDH---------------SAA----RNGRPVSS---E-DCQLRRSC
A0A3B5B4X7_BCL2L1-      -RTEGDKTN-------------SAA----SNGLLVNS-------------
A0A3B4BFZ8_BCL2L1-      -QCEGNKAA-------------NVP-----NGMLTNR-N-G-NRQTLASL
A0A3Q3FUB6_BCL2L1-      -RTEGDMEN-------------SAA----SNGFLVNS-RNR-AGQSVMSS
A0A3B5MGS2_BCL2L1-      -RTNWEGDS-------------RVP----RNGPLVNS---W-AGHPGKPR
M4A558_BCL2L1-01        -RTNWEGDS-------------RVP----SNGRLVNS---R-AGPPGKPR
A0A3P9QFB3_BCL2L1-      -RTNWDGDS-------------RGP----SNGPLVNS---R-AGSRGKSQ
A0A087YBW4_BCL2L1-      -RTNWDGDS-------------RGP----SNGPLVNS---W-AGSPGKSR
A0A3B3VWI7_BCL2L1-      -RTNWDGDS-------------RGP----SNGPLVNS---W-AGSPGKSR
A0A3B3XN57_BCL2L1-      -RTNWDGDS-------------RGP----SNGPLVNS---W-AGSPGKSQ
A0A3Q2C6K4_BCL2L1-      -RTEGDKDA-------------SAS----SNGPLFNS---R-PSPPGKPR
A0A3Q2NRP4_BCL2L1-      -RTEGDKDS-------------PAS----SNGPLVSS---W-AGSPWQPW
A0A0B4KJI5_BCL2L1-      -RTEADKAN-------------SAA----TNGLLANS-SNG-GGQPGAD-
A0A3Q1JZ46_BCL2L1-      ---VGDRPN-------------SAA----ANGLPVS----R-SGELGNSS
A0A3Q1JZ46_BCL2L1-      ---VGDRPN-------------SAA----ANGLPVS----R-SGELGNSS
A0A3Q3NFM4_BCL2L1-      -RTEGDMTG-------------AAA----TNGLLVNS-RYV-SGRPGMSS
A0A3Q3NFM4_BCL2L1-      -RTEGDMTG-------------AAA----TNGLLVNS-RYV-SGRPGMSS
A0A3B4V9K8_BCL2L1-      -RTEGDKAN-------------SAA----SNGLLVNS-SDR-CGQPGTSS
A0A3B4XS24_BCL2L1-      -RTEGDKAS-------------SAA----SNGLLVNS-SDR-CGQPGTSS
C1BLI0_BCL2L1-01        -RTNVDKTN-------------VSP----VNGSVEND-RNC-IGSLGISS
C0HAD8_BCL2L1-01        -RTEGDD----------------AI----ANGSVGNS-RS----NLAKPS
A0A3B3ZMX9_BCL2L1-      ----GTEIDTERDRDL------LGL----GDRSVDRN---------STPS
A0A3B5K6B9_BCL2L1-      -RTDGQFV--------------TTQ----FNGTFNGA---S-PG--TPPA
A0A3B5K6B9_BCL2L1-      -RTDGQFV--------------TTQ----FNGTFNGA---S-PG--TPPA
H3CH49_BCL2L1-01        -RTEGQFG--------------TTQ----SNGTFNGA---S-PG--TPPA
A0A3B3TFR4_BCL2L1-      -QTGGGEGEAAGA---------VAH----ANGSVSSGNSVG-QG--APLE
A0A3P8XYL5_BCL2L1-      -RTEGGEVEEVAAV--------TMH----PNGTMNGT--SP-GT--PTQQ
Q90Z98_BCL2L1-02        -RTDGAEENGEGAAGA------TTL----VNGTMNRTNASS-TG--TPPQ
Q90Z98_BCL2L1-01        -RTDGAEENGEGAAGA------TTL----VNGTMNRTNASS-TG--TPPQ
A0A059PJI5_BCL2L1-      -----GQVAEENAVGAGESETPTAV----VNGTLNGT--GS-AG--TPPR
A0A3B4DTL9_BCL2L1-      -RTEGGQAAEENAEGA--AVTPTAV----VNGSVNGT--SH-G----PAG
A0A3Q2FR43_BCL2L1-      -GTGAQGAEQDDERTP------ETH----ANGTFNGT---S-PG--SP--
B5XAY3_BCL2L1-01        -RTEVGQVE--GGAAV------LTY----VNGTSPGT---P-PPRQSPPS
W5MG74_BCL2L1-01        -RTGGAEAVGSGSPNA------EER----TNGAANGG---G-GP--VSRQ
A0A2U9BY16_BCL2L1-      -RTDRGEAGLGEEQQT------APH----ANGTLNGV---N-PG--TPPE
A0A3Q3B3X5_BCL2L1-      -RTDAGDAGLEDAEMT------ETH----ANGTFNGT---S-PG--TPPA
A0A3B3IB64_BCL2L1-      -RTAAGEVG--EEQST------ETH----ANGTFNGT---T-PG--TPPL
A0A3P9JYH1_BCL2L1-      -RTAAGEVG--EEQST------ETH----ANGTFNGT---T-PG--TPPL
A0A3B3DHA1_BCL2L1-      -RTAAGEVG--EEQST------ETH----ANGTFNGT---S-PG--TPPL
A0A3Q0RTF8_BCL2L1-      -RTDGGAAGLDEEQRI------DTH----ANGTFNGT---S-PG--TPPA
I3IZK7_BCL2L1-01        -RTDGGAAGLDEEQRI------DTH----ANGTFNGT---S-PG--TPPA
A0A2U9BY16_BCL2L1-      -RTDRGEAGLGEEQQT------APH----ANGTLNGV---N-PG--TPPE
A0A2U9BY16_BCL2L1-      -RTDRGEAGLGEEQQT------APH----ANGTLNGV---N-PG--TPPE
A0A2U9BY16_BCL2L1-      -RTDRGEAGLGEEQQT------APH----ANGTLNGV---N-PG--TPPE
A0A0D6DR75_BCL2L1-      -RTDGGEVESAEEQRI------ATH----ANGTFNGR---S-PG--TPPA
A0A3Q3WIW8_BCL2L1-      -RTEGGQAVSDEEQRV------ATH----ANGTFNGT---S-PG--TPPR
A0A219P0Y3_BCL2L1-      -RTDGGEAGLGEEQRV------ATH----ANGTFNGM---S-PG--TPPA
A0A3Q3MX20_BCL2L1-      -RTDGGEAESGEEQRI------ATH----ANGTFNGT---S-PG--TPPA
A0A3Q3G2E1_BCL2L1-      -RTDGAGAGSGEEQQV------ATH----ANGTFNGT---S-PG--TPPA
A0A3Q3G2E1_BCL2L1-      -RTDGAGAGSGEEQQV------ATH----ANGTFNGT---S-PG--TPPA
A0A3Q3G2E1_BCL2L1-      -RTDGAGAGSGEEQQV------ATH----ANGTFNGT---S-PG--TPPA
A0A3Q1GZ93_BCL2L1-      -RTDGGEDGLSEEQRI------ATH----ANGTFNGR---S-PG--TPPA
A0A3Q1GZ93_BCL2L1-      -RTDGGEDGLSEEQRI------ATH----ANGTFNGR---S-PG--TPPA
A0A3Q1GZ93_BCL2L1-      -RTDGGEDGLSEEQRI------ATH----ANGTFNGR---S-PG--TPPA
A0A3B4V3T1_BCL2L1-      -RTDGGEAGLVEEQRI------ATH----ANGTFNGT---S-PG--TRAE
A0A3B4XU17_BCL2L1-      -RTDGGEAGLVEEQRI------ATH----ANGTFNGT---S-PG--TRPE
A0A3P9MKK4_BCL2L1-      -ETEE------DHSAARNGRPVSSEDCQLRRSCPCCAS------------
A0A3B3I2Q5_BCL2L1-      -ETEE------DHSDARNRRLVSSEDGRLRRSCPCCAS------------
A0A3P9I2N4_BCL2L1-      -ETEE------DHSAARNGRQVSSEDGQLRRSCPCCAS------------
A0A3B3QRZ2_BCL2L1-      -RTEGSGQADGREGVM----VTATH----VNGSVIAGGTSS-QV--SPVP
A0A3B3ZMX9_BCL2L1-      -QSDTEHLGLGDRGVDRARLQRETE----VDSTELRLDSAS-DS--APVH
G3NJY1_BCL2L1-01        -RTGG-----GVEAGAAGGQRGATH----SNGTFNGTS----PG--TPPA
A0A2U9BY16_BCL2L1-      -QTDR-----GEAGLG-EEQQTAPH----ANGTLNGVN----PG--TPPE
A0A3Q3DUT7_BCL2L1-      -RTDG-----REEASGEEEQRVQTP----ANGTTNGTS---------PPA
A0A3Q3DUT7_BCL2L1-      -RTDG-----REEASGEEEQRVQTP----ANGTTNGTS---------PPA
A0A3Q3DUT7_BCL2L1-      -RTDG-----REEASGEEEQRVQTP----ANGTTNGTS---------PPA
A0A3B1JJ42_BCL2L1-      -RTEG-----GQEAEG-NAEAAGVTPTAVVNGSVNGTSHGA-AG--SPTS
A0A3P8UWG7_BCL2L1-      -RTDG-----EEAGLG-AEQRTSTH----ANGTVNGTS----SG--TPPA
A0A3Q3IVF5_BCL2L1-      -RTDG-----EEA----------TH----ANGTFNGTS----PG--TPPA
A0A3Q1DHJ3_BCL2L1-      -RTDG-----GEARLG-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3Q1DHJ3_BCL2L1-      -RTDG-----GEARLG-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3Q1DHJ3_BCL2L1-      -RTDG-----GEARLG-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3P8TL99_BCL2L1-      -RTDG-----GEARLG-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3P8TL99_BCL2L1-      -RTDG-----GEARLG-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3Q1FR00_BCL2L1-      -RTDG-----GEARLG-EDQRTETH----ANGTFNGTS----PG--TPPP
A0A3B4Z3X2_BCL2L1-      -RTDG-----GEARLA-EEQRTETH----ANGTFNGTS----PG--TPPP
A0A3B4Z3X2_BCL2L1-      -RTDG-----GEARLA-EEQRTETH----ANGTFNGTS----PG--TPPP
C3VIT1_BCL2L1-01        -RTGA-----GDGGLG-EEQSTETH----ANGTFTGTS----PG--TPPV
A0A3P8P0F1_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3Q2X557_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3P9D632_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3P9D632_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3Q4N4B5_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3B4FNX1_BCL2L1-      -RTDG-----GAAGLD-EEQRIDTH----ANGTFNGTS----PG--TPPA
A0A3Q2QPL9_BCL2L1-      -DGGA-----RDAESD-EEQTAETH----ANGTVNGTS----SG--SPRR
A0A3B5PQJ0_BCL2L1-      -GTAA-----GDVGMD-DEQTLETH----ANGTFNGTS----PG--SPRR
A0A087X9B7_BCL2L1-      AGDAA-----GDAGMD-DEQTLETH----ANGTFNGTS----PG--SPRR
A0A3B3TUS7_BCL2L1-      AGDAA-----GDAGMD-DEQTLETH----ANGTFNGTS----PG--SPRR
A0A3B3WI27_BCL2L1-      AGDAA-----GDAGMD-DEQTLETH----ANGTFNGTS----PG--SPRR
A0A3P9N9Y4_BCL2L1-      ARDAA-----GDGGMD-DEQTLETH----ANGTFNGTS----PG--SPRR
A0A3Q3BEB7_BCL2L1-      -RTE--------------KASSAPSNGLLVNSRDGQS-------------
A0A3P8VMA1_BCL2L1-      -QREG------------EEVTTASSNGVPQTPSAVLQ-------------
A0A345BSW9_BCL2L1-      -RTDG------------AEENGEGAAGTTTLVNGSMN-----RT--PPQS
A0A286MU87_BCL2L1-      -RTDG------------DEAIANGSVGNYR--NSRSN-----LA--KPSS
A0A3P8XFS0_BCL2L1-      -RTEG------------EEATANGSVGNGR--NSRRN-----LG--KPST
A0A3P8XFS0_BCL2L1-      -RTEG------------EEATANGSVGNGR--NSRRN-----LG--KPST
A0A0F7L1T6_BCL2L1-      -RTEG------------EKRSPAASNGLLVRSRNRGG---------ASPS
H2U5I3_BCL2L1-01        -RTEG------------EKRSPGASNGLLVRSRNRGG---------ASPS
H2U5I3_BCL2L1-02        -RTEG------------EKRSPGASNGLLVRSRNRGG---------ASPS
A0A3Q3J5K3_BCL2L1-      -RTEG------------DRTNPATTNGLG---------------------
A0A3Q1EVP6_BCL2L1-      -RTDG------------DKASSASSNGLLVN--NRDG-------------
A0A3Q1BQA0_BCL2L1-      -RTDG------------DKANSASSNGLLVN--SRGG-------------
A0A3P8U812_BCL2L1-      -RTDG------------DKANSASSNGLLVN--SRGG-------------
E6ZFR0_BCL2L1-01        -RTEG------------DKANSAARNGLLASKNTSGQ-----PG--TSSS
G3P7B4_BCL2L1-01        -RTEG------------DKANSASVPGRGSSAGQPGM-----SS--PPPP
A0A3Q3X5M5_BCL2L1-      -RTEG------------DKASSAARNGLLVNSSSRGG---------LSPS
A0A2U9BIG9_BCL2L1-      -RTEG------------DKANSAASNGLLVDGGNRCGQLGT-DP--LPPD
                                                                          

A0A3Q1FR00_BCL2L1-      ST-----------------ATMDAVKEALRDTANEFELRYARAFSDLHSQ
R4JQR8_BCL2L1-01        -----------------------QIQLKLRSLGDEFQERFQTQFDDMVNQ
A0A346RRN1_BCL2L1-      -----------------------QVQLTLRTIGDEFQERFRTQFDDMVDQ
Q2TAP5_BCL2L1-01        IV-------------------EEEVLQALLEATEEFELRYQRAFSDLTSQ
Q91828_BCL2L1-01        IV-------------------EEEVLQALLEATEEFELRYQRAFSDLTSQ
I7GKS6_BCL2L1-01        LN--------------------------------------RRWRPPVPSM
A0A2K5EBP4_BCL2L1-      LI--------------------------------------RRWRPPVPSM
A0A2K5Q6R6_BCL2L1-      LI--------------------------------------RRWRPPVPSM
A0A2K6UWY8_BCL2L1-      LI--------------------------------------RRWRPPVPSM
A0A2K5M8B1_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A2K5H963_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A2K5VPG2_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A2K5YR37_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A2R8Z9D7_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A096NV05_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A2K6QFA2_BCL2L1-      ---------------------------MWKRTGLRPQKGLNRRWRPPVPS
A0A1U7T4L4_BCL2L1-      ---------------------------MWKRTGLRPQKGLSRRWRPPVPS
A0A2K6G3C5_BCL2L1-      ---------------------------MQKRTGLRPQKRLNRRWRPPVPL
A0A3Q1LRT3_BCL2L1-      AT-----GHSRSL-DARKMIPMTTVKQALREASNEFKLRYQQTFSDLMSQ
H9GHK7_BCL2L1-01        AS-----EHPELLEEEEEENPRVDVSQTLREAGDEFELRYRRAFSDLTSQ
Q07816_BCL2L1-04        AT-----VHRSSL-EVHEIVRASDVRQALRDAGDEFELR--GFVRGERGQ
A0A493TIA6_BCL2L1-      AA-----VHRSSL-EVHELVQSAAVRQALREAGDEFELRYRRAFSDLTSQ
Q07816_BCL2L1-03        AT-----VHRSSL-EVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQ
Q07816_BCL2L1-02        AT-----VHRSSL-EVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQ
Q07816_BCL2L1-01        AT-----VHRSSL-EVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQ
G1N5N5_BCL2L1-01        AA-----VHRSSL-EVHEIVRASDVRQTLRDAGDEFELRYRRAFSDLTSQ
A0A452ILL8_BCL2L1-      AA-----GHSNSL-EAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQ
A0A452ILL8_BCL2L1-      AA-----GHSNSL-EAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQ
K7F655_BCL2L1-01        AA-----GHSNSL-EAHERVPAAEVRQALREAGDEFELRYRRAFSDLTSQ
A0A452E1B1_BCL2L1-      AT-----GHSRSL-DAGKMIPTAVVKQALREASNECELRYQQTFSDLTSQ
W5PSA5_BCL2L1-01        AT-----GHSRSL-DTGKMIPMAVVKQALREASNECELRYQQTFSDLTSQ
P53563_BCL2L1-02        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
P53563_BCL2L1-03        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A287CZ07_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELWYWRAFSDLTSQ
A0A3Q2H0F6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
F6WA14_BCL2L1-01        AT-----GHSSSL-DAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQ
G3WKX6_BCL2L1-01        AT-----GHSSSL-DAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQ
M3XA94_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
M3XA94_BCL2L1-02        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
H0X6V2_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
G3SPN0_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q2PFS6_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
O35843_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
M3XA94_BCL2L1-03        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
G1RER8_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A1S2ZQT6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q64373_BCL2L1-09        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q64373_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
P53563_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
O77737_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q9MYW4_BCL2L1-01        AT-----GHSSSL-DAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQ
A0A3Q2H0F6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
L8J061_BCL2L1-01        AT-----GHSRSS-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q05KJ0_BCL2L1-02        AT-----GHSRSS-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q05KJ0_BCL2L1-01        AT-----GHSRSS-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
E2IV76_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALKEAGDEFELRYRRAFSDLTSQ
A0A2K6G3C5_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALKEAGDEFELRYRRAFSDLTSQ
B2Z3Z4_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
G3HEA7_BCL2L1-02        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
G3HEA7_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A1U7T4L4_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
M3Z2H9_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A1U7QU73_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A0D9RJZ8_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQTLREAGDEFELRYRRAFSDLTSQ
A0A286Y5D6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A250YD48_BCL2L1-      AT-----GHSSSL-DAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQ
A0A1L5BWY3_BCL2L1-      AT-----GHSSSL-DAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQ
I3MUP5_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
I3MUP5_BCL2L1-02        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
I3MUP5_BCL2L1-03        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
G1P9D2_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5EBP4_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
E2IV75_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
F7IT34_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q76LT7_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5Q6R6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5Q6R6_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5M8B1_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5H963_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q8SQ42_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5VPG2_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K5YR37_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2R8Z9D7_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A096NV05_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2J8VIH3_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K6QFA2_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K6QFA2_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A2K6UWY8_BCL2L1-      AT-----GHSSSL-DAREVIPMAAIKQALREAGDEFELRYRRAFSDLTSQ
E2IV77_BCL2L1-01        AT-----GHSSSL-DAREVIPMAAIKQALREAGDEFELRYRRAFSDLTSQ
A0A452SDS4_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A384D3U1_BCL2L1-      AT-----GHSSSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A452FWV3_BCL2L1-      AT-----GHSRSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
Q9MZS7_BCL2L1-01        AT-----GHSRSL-DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
H3ANS8_BCL2L1-01        GAVNGLPAGSSSRLEAQAVSGPEAVKRTLREAGEEFELRYSRAFSDLSSQ
A0A452FHY1_BCL2L1-      GA-----TGHTE-----ESGPVATAQQAPREAGSEFELRHQQTVSDLTSQ
A0A452FHY1_BCL2L1-      GA-----TGHTE-----ESGPVATAQQAPREAGSEFELRHQQTVSDLTSQ
A0A1S3EPX7_BCL2L1-      GA-----TGHSSSSEAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQ
A0A218USB3_BCL2L1-      GA-----TVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
H0Z8G3_BCL2L1-01        GA-----TVHQNSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
A0A218USB3_BCL2L1-      GA-----TVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
U3JSL7_BCL2L1-01        GA-----SVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
A0A218USB3_BCL2L1-      GA-----TVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
A0A218USB3_BCL2L1-      GA-----TVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
Q4U2V6_BCL2L1-01        GA-----TVHQSSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQ
D2ITA2_BCL2L1-02        TP-----QG------------TEAVRAALLESVEEFELRYTLAFSDLSSQ
A0A3B3E2W4_BCL2L1-      PC-----CA----------S-MDAIKSTLKDSANEFERRFSQGFSDLSLQ
A0A3B3I2Q5_BCL2L1-      PC-----CA----------S-MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3P9I2N4_BCL2L1-      PC-----CA----------S-MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3P9MKK4_BCL2L1-      PC-----CA----------S-MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3B5B4X7_BCL2L1-      -------RG----------G-IEAVKAALKDSADEFELLFTQAFSDLSSQ
A0A3B4BFZ8_BCL2L1-      PP-----DD----------H-LDAIKTALTDSADEFEELFTQAFSNLSSQ
A0A3Q3FUB6_BCL2L1-      SP-----HT----------D-IEAVKAALLDSADEFELLFTQAFSDLSSQ
A0A3B5MGS2_BCL2L1-      GP-----PA----------G-VEVVKSVLKDAAEEFERLYTQSFKHLSLQ
M4A558_BCL2L1-01        GP-----MA----------G-VEVVKSVLKDAAEEFERLYTQSFKHLSLQ
A0A3P9QFB3_BCL2L1-      GP-----P-------------VEVVKSVLKDAAEEFERLYTQSFKHLSLQ
A0A087YBW4_BCL2L1-      DP-----PT----------G-VKVVKLVLKDAAEEFERLYTQSFKHLSLQ
A0A3B3VWI7_BCL2L1-      DP-----PT----------G-VKVVKLVLKDAAEEFERLYTQSFKHLSLQ
A0A3B3XN57_BCL2L1-      DP-----PT----------G-VEVVKSVLKDAAEEFERLYTQSFKHLSLQ
A0A3Q2C6K4_BCL2L1-      AP-----HG----------S-IEAVKSALKDSANEFELLFSQSFSDLSMQ
A0A3Q2NRP4_BCL2L1-      AP-----HG----------R-AEAVKSALRDSADEFEHLFTQSFSHLSLQ
A0A0B4KJI5_BCL2L1-      ---------------------IEAVKAALRDSSEEFELLFTQAFSDLSTQ
A0A3Q1JZ46_BCL2L1-      PP-----CK----------S-MEAVKTALRDSADEFELLFTQAFSDLSSQ
A0A3Q1JZ46_BCL2L1-      PP-----CK----------S-MEAVKTALRDSADEFELLFTQAFSDLSSQ
A0A3Q3NFM4_BCL2L1-      SP-----HG----------G-VEAVKAALRDSAEEFELLFTQAFSDLSSQ
A0A3Q3NFM4_BCL2L1-      SP-----HG----------G-VEAVKAALRDSAEEFELLFTQAFSDLSSQ
A0A3B4V9K8_BCL2L1-      PP-----HG----------G-IEAVKSALKDSADEFELLFNQAFSDLSTQ
A0A3B4XS24_BCL2L1-      PP-----HG----------G-IEAVKSALKDSADEFELLFNQAFSDLSTQ
C1BLI0_BCL2L1-01        SP-----QG----------G-IEAVKAALRDSADEFELRYTRAFNDPSSQ
C0HAD8_BCL2L1-01        SP-----QG----------G-MEPVKAALRDSVDEFELRYTRAFSDLSSQ
A0A3B3ZMX9_BCL2L1-      LR-----LR--------LDS-ASDSAPALRDSANEFELRFSRAFSDLHRQ
A0A3B5K6B9_BCL2L1-      TS-----LA---------TS-LDTVKEALRDTGNEFELRYTCAFSDLHNQ
A0A3B5K6B9_BCL2L1-      TS-----LA---------TS-LDTVKEALRDTGNEFELRYTCAFSDLHNQ
H3CH49_BCL2L1-01        PS-----QH-----QQSLTS-LDAVKEALRDTGNEFELRYTCAFSDLHNQ
A0A3B3TFR4_BCL2L1-      GA-----TP---------QG-LEAVKEALRLSANEFEFRYQRAFSDLSSQ
A0A3P8XYL5_BCL2L1-      SP-----PSSPRRTV----G-LDAVKEALRDSANEFELRYALAFSDLSSQ
Q90Z98_BCL2L1-02        SP-----ASSPQRQTNGSGG-LDAVKEALRDSANEFELRYSRAFNDLSSQ
Q90Z98_BCL2L1-01        SP-----ASSPQRQTNGSGG-LDAVKEALRDSANEFELRYSRAFNDLSSQ
A0A059PJI5_BCL2L1-      SP-----TLSPQRQVNGSAS-LEAVKEALRDSGNEFELRYSRAFSDLSSQ
A0A3B4DTL9_BCL2L1-      SP-----TSSPQRRSNGAGG-LDAVKEALRDSANEFELRYSRAFSDLSSQ
A0A3Q2FR43_BCL2L1-      -----------RRQQASTAA-MEAVKAALRDTACEFELRYARAFNDLHST
B5XAY3_BCL2L1-01        SP-----RR--------TAG-LDAVKEALRDSANEFELRYARAFSDLSSQ
W5MG74_BCL2L1-01        PP-----QG------------IEAVQGALRDSANEFELRYGRAFSDLSSQ
A0A2U9BY16_BCL2L1-      SP-----LR--LQRLPSSPS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q3B3X5_BCL2L1-      SP-----LR--QQPLPTTAN-MDKVKEALRDTANEFELRYARAFSDLHSQ
A0A3B3IB64_BCL2L1-      SP-----LR--EQQLPSTTN-MDAVKEALRDTANEFELRYALAFNNLHSQ
A0A3P9JYH1_BCL2L1-      SP-----LR--EQQLPSTTN-MDAVKEALRDTANEFELRYALAFNNLHSQ
A0A3B3DHA1_BCL2L1-      SP-----LR--QQQLPSTTN-MDAVKEALRDTANEFELRYALAFNNLHSQ
A0A3Q0RTF8_BCL2L1-      SP-----QR--QQQPPSTTN-LDAVKEALRDTANEFELRYARAFNDLHSQ
I3IZK7_BCL2L1-01        SP-----QR--QQQPPSTTD-LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A2U9BY16_BCL2L1-      SP-----LR--LQRLPSSPS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A2U9BY16_BCL2L1-      SP-----LR--LQRLPSSPS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A2U9BY16_BCL2L1-      SP-----LR--LQRLPSSPS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A0D6DR75_BCL2L1-      SP-----LR--QQRLPSPTS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q3WIW8_BCL2L1-      SP-----LR----LQPSTTS-LDAVKDALRDSANEFELRYARAFSDLHNQ
A0A219P0Y3_BCL2L1-      SP-----LR--QQQLPSTTS-LDAVKEALRDSANEFELRYARAFSDLHHQ
A0A3Q3MX20_BCL2L1-      SP-----LR--QEHLQSTAS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q3G2E1_BCL2L1-      SP-----HRQQQQRLPATTN-LDAVKEALRDSANEFELRYASAFSDLHNQ
A0A3Q3G2E1_BCL2L1-      SP-----HRQQQQRLPATTN-LDAVKEALRDSANEFELRYASAFSDLHNQ
A0A3Q3G2E1_BCL2L1-      SP-----HRQQQQRLPATTN-LDAVKEALRDSANEFELRYASAFSDLHNQ
A0A3Q1GZ93_BCL2L1-      SP-----LR--QQRLPSTTS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q1GZ93_BCL2L1-      SP-----LR--QQRLPSTTS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q1GZ93_BCL2L1-      SP-----LR--QQRLPSTTS-LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3B4V3T1_BCL2L1-      SP-----QR--QQRLPSTTS-LDAVKEALRDSANEFELRYSRAFSDLHNQ
A0A3B4XU17_BCL2L1-      SP-----QR--QQRLPSTTS-LDAVKEALRDSANEFELRYSRAFSDLHNQ
A0A3P9MKK4_BCL2L1-      ---------------------MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3B3I2Q5_BCL2L1-      ---------------------MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3P9I2N4_BCL2L1-      ---------------------MDAIKSTLKDSADEFERRFHQGFSDLSVQ
A0A3B3QRZ2_BCL2L1-      EQ-----PLHSPSPSPQG---LEAVKEALRDSANEFELRYSRAFSDLSSQ
A0A3B3ZMX9_BCL2L1-      SP-----APLLD---------LDAVKEALRDSANEFELRFSRAFSDLHRQ
G3NJY1_BCL2L1-01        SP-----LLQQRSPSTAS---LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A2U9BY16_BCL2L1-      SP-----LRLQRLPSSPS---LDAVKEALRDSANEFELRYARAFSDLHNQ
A0A3Q3DUT7_BCL2L1-      SP-----LREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQ
A0A3Q3DUT7_BCL2L1-      SP-----LREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQ
A0A3Q3DUT7_BCL2L1-      SP-----LREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQ
A0A3B1JJ42_BCL2L1-      SP-----QRRANGARG-----LDAVKEALRDSANEFELRYSRAFSDLSSQ
A0A3P8UWG7_BCL2L1-      SP-----LRQQHSASDTS---LDSIKEALRDSANEFELRYARAFSDLHQQ
A0A3Q3IVF5_BCL2L1-      SP-----LRQQQLPSTAN---LDAVKEALRDSANEFELRYARAFSDLHHQ
A0A3Q1DHJ3_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q1DHJ3_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q1DHJ3_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3P8TL99_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3P8TL99_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q1FR00_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3B4Z3X2_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3B4Z3X2_BCL2L1-      SP-----RRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQ
C3VIT1_BCL2L1-01        SP-----LRQQPLPSTTTTTRLDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3P8P0F1_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q2X557_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3P9D632_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3P9D632_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q4N4B5_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3B4FNX1_BCL2L1-      SP-----QRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQ
A0A3Q2QPL9_BCL2L1-      RQ-----QQPASTAA------MEAVKVALRETACEFELRYARAFNDLHST
A0A3B5PQJ0_BCL2L1-      -------HQAASAST------MDAVKVALRDTAREFELRYSRAFNDLHST
A0A087X9B7_BCL2L1-      -------QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHST
A0A3B3TUS7_BCL2L1-      -------QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHST
A0A3B3WI27_BCL2L1-      -------QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHST
A0A3P9N9Y4_BCL2L1-      -------QQAASAST------MDAVKVTLRDTAREFELRYSRAFNDLHST
A0A3Q3BEB7_BCL2L1-      ---------GKKIWPRRSD--IEAVKSALKDSADEFERLYTQSFSHLSLQ
A0A3P8VMA1_BCL2L1-      ---------------HCSG--AEAVKAALKDSADEFELRFTQAFRNLFLK
A0A345BSW9_BCL2L1-      PA-----TSPQHQTNGSGG--LDAVKEALRDSANEFELRYSRAFNDLSSQ
A0A286MU87_BCL2L1-      P---------------QGG--MEPVKAALRDSVDEFELRYTRAFSDLSSQ
A0A3P8XFS0_BCL2L1-      P---------------QGC--MEAVKAALRDSADEFELRYTRAFSDLSSQ
A0A3P8XFS0_BCL2L1-      P---------------QGC--MEAVKAALRDSADEFELRYTRAFSDLSSQ
A0A0F7L1T6_BCL2L1-      A---------------GAG--IEAVNAALRDSAEEFEKLFAQAFSDLSSQ
H2U5I3_BCL2L1-01        A---------------GAG--IEAVNAALRDSAEEFEKLFAQAFSDLSSQ
H2U5I3_BCL2L1-02        A---------------GAG--IEAVNAALRDSAEEFEKLFAQAFSDLSSQ
A0A3Q3J5K3_BCL2L1-      ---------------------IEAVKAALRDSADEFELRFTQAFSDLSSQ
A0A3Q1EVP6_BCL2L1-      ---------------------IEAVKSTLKDAADEFELLFTQTFSDLSSQ
A0A3Q1BQA0_BCL2L1-      ---------------------IEAVKSALKDAADEFELLFTQAFSDLSSQ
A0A3P8U812_BCL2L1-      ---------------------IEAVKSALKDAADEFELLFTQAFSDLSSQ
E6ZFR0_BCL2L1-01        S---------------GAD--IEAVKAALRDSADEFELLFTQAFSDLSSQ
G3P7B4_BCL2L1-01        P---------------SGD--TEAVKAALQDSANEFELLFTQAFSDLSLQ
A0A3Q3X5M5_BCL2L1-      T---------------GAD--MEAVKSALRDSANEFEQLFTQAFSDLSSQ
A0A2U9BIG9_BCL2L1-      G---------------G----VGAVKEALRDSAHEFEQLFNQAFSDLSLQ
                                                                          

A0A3Q1FR00_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
R4JQR8_BCL2L1-01        LHI--TEATAYPTFQRVVQELFIDGNINWGRIVALFGFGGSLS-------
A0A346RRN1_BCL2L1-      LHI--TEATAYPTFQRVVQELFIDGNINWGRVVALFGFGGALS-------
Q2TAP5_BCL2L1-01        LHI--TQDTAQQSFQQVMGELFRDG-TNWGRIVAFFSFGRALC-------
Q91828_BCL2L1-01        LHI--TQDTAQQSFQQVMGELFRDG-TNWGRIVAFFSFGRALC-------
I7GKS6_BCL2L1-01        ATHPGTPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5EBP4_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6UWY8_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5M8B1_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5H963_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5VPG2_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5YR37_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2R8Z9D7_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A096NV05_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A1U7T4L4_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6G3C5_BCL2L1-      MAT--HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A3Q1LRT3_BCL2L1-      LRI--TPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTLC-------
H9GHK7_BCL2L1-01        LHI--TLGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-04        GDA--GTGGTHCVLDDHVLDRPSRS-LDPGEWRL-----GALCGSVWEQR
A0A493TIA6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-03        LHI--TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC-------
G1N5N5_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC-------
A0A452ILL8_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A452ILL8_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
K7F655_BCL2L1-01        LHI--TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A452E1B1_BCL2L1-      LHI--TPGTTYQSFEQVINELFQDG-VNWCRNVAFFSFGGALC-------
W5PSA5_BCL2L1-01        LHI--TPGKAYQSFEQVINELFQDG-VNWGRNVAFFSFGGALC-------
P53563_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
P53563_BCL2L1-03        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A287CZ07_BCL2L1-      LHI--TLGTAYQSFEQVVNELFRDG-VNWGHIVAFLSFGGALC-------
A0A3Q2H0F6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
F6WA14_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G3WKX6_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
H0X6V2_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G3SPN0_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q2PFS6_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
O35843_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-03        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G1RER8_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A1S2ZQT6_BCL2L1-      LHI--TPATAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q64373_BCL2L1-09        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q64373_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
P53563_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
O77737_BCL2L1-01        LHI--TPGTAYQSFEQVLNELFRDG-VNWGRIVAFFSFGGALC-------
Q9MYW4_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A3Q2H0F6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
L8J061_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q05KJ0_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q05KJ0_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
E2IV76_BCL2L1-01        LHI--TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6G3C5_BCL2L1-      LHI--TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
B2Z3Z4_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G3HEA7_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G3HEA7_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A1U7T4L4_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
M3Z2H9_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A1U7QU73_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A0D9RJZ8_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A286Y5D6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A250YD48_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A1L5BWY3_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-02        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-03        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
G1P9D2_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5EBP4_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
E2IV75_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
F7IT34_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q76LT7_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5M8B1_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5H963_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q8SQ42_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5VPG2_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K5YR37_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2R8Z9D7_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A096NV05_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2J8VIH3_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A2K6UWY8_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
E2IV77_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A452SDS4_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A384D3U1_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A452FWV3_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q9MZS7_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
H3ANS8_BCL2L1-01        LHI--TPGTAYQSFEQVVNELFRDG-VNWGRVVAFFAFGGALC-------
A0A452FHY1_BCL2L1-      LHT--TPGTAYQSFEQVMYELFWDG-VNWDHTVAFFSFRGALC-------
A0A452FHY1_BCL2L1-      LHT--TPGTAYQSFEQVMYELFWDG-VNWDHTVAFFSFRGALC-------
A0A1S3EPX7_BCL2L1-      LHI--TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
H0Z8G3_BCL2L1-01        LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
U3JSL7_BCL2L1-01        LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
Q4U2V6_BCL2L1-01        LHI--TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC-------
D2ITA2_BCL2L1-02        LPI--TPATAYGSFESVMDEVFRDS-INWGRIVGLFAFGGALC-------
A0A3B3E2W4_BCL2L1-      FHI--TPDTAYQNFKSVLDELFKDG-INWGRVVGLFVFGGVLC-------
A0A3B3I2Q5_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3P9I2N4_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3P9MKK4_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3B5B4X7_BCL2L1-      LDI--TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC-------
A0A3B4BFZ8_BCL2L1-      LDI--TPDTAYNSFKSVMDEVFKDG-VNWGRIVGLFVFGGVLS-------
A0A3Q3FUB6_BCL2L1-      LDI--TPNTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
A0A3B5MGS2_BCL2L1-      LDI--TPDTAYHSFKTVLDELFKGG-VNWGRVVAMFTFGGILC-------
M4A558_BCL2L1-01        LDI--TPDTAYHSFKTVLDELFKGG-VNWGRVVAMFTFGGILC-------
A0A3P9QFB3_BCL2L1-      LDI--TPDTAYHSFKTVLDELFKGE-VNWGRVVAMFTFGGILC-------
A0A087YBW4_BCL2L1-      LDI--TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC-------
A0A3B3VWI7_BCL2L1-      LDI--TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC-------
A0A3B3XN57_BCL2L1-      LDI--TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC-------
A0A3Q2C6K4_BCL2L1-      LDI--TPDTAYHSFKAVLDELFKDG-INWGRVVGLFAFGGVLC-------
A0A3Q2NRP4_BCL2L1-      LDI--TPDTAYHSFKAVLDELFKDG-VNWGRVVGLFAFGGVLC-------
A0A0B4KJI5_BCL2L1-      LDI--TPDTAYHSFKSVMDEVFKDG-VNWGRVVGLFAFGGVLC-------
A0A3Q1JZ46_BCL2L1-      LDV--TPDTAYQSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC-------
A0A3Q1JZ46_BCL2L1-      LDV--TPDTAYQSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC-------
A0A3Q3NFM4_BCL2L1-      LDI--TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
A0A3Q3NFM4_BCL2L1-      LDI--TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
A0A3B4V9K8_BCL2L1-      LDI--TPDTAYHSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC-------
A0A3B4XS24_BCL2L1-      LDI--TPDTAYHSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC-------
C1BLI0_BCL2L1-01        LHI--TPATAYHSFESVMNEVFRDG-VNWGRVVGLFAFGGALC-------
C0HAD8_BCL2L1-01        LHI--TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3B3ZMX9_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALA-------
A0A3B5K6B9_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B5K6B9_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
H3CH49_BCL2L1-01        LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B3TFR4_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3P8XYL5_BCL2L1-      LHL--TPATAYQSFASVMDEVFRDG-VNWGRVVGLFAFGGALC-------
Q90Z98_BCL2L1-02        LHI--TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC-------
Q90Z98_BCL2L1-01        LHI--TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A059PJI5_BCL2L1-      LHI--TPVTVYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B4DTL9_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3Q2FR43_BCL2L1-      LHI--TPATAYQSFENVMNEVFRDG-VNWGRIVGLFAFGGALC-------
B5XAY3_BCL2L1-01        LHI--TPSTAYQSFENVMDEVFRDG-VNWGRVVGLFSFGGALC-------
W5MG74_BCL2L1-01        LHI--TPATAYQSFEHVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS-------
A0A3Q3B3X5_BCL2L1-      LHI--TPGTVYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B3IB64_BCL2L1-      LHI--TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC-------
A0A3P9JYH1_BCL2L1-      LHI--TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC-------
A0A3B3DHA1_BCL2L1-      LHI--TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC-------
A0A3Q0RTF8_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
I3IZK7_BCL2L1-01        LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS-------
A0A2U9BY16_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS-------
A0A2U9BY16_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS-------
A0A0D6DR75_BCL2L1-      LHI--TPATAYQSFANVMDEVFRDG-VNWGRIIGLFAFGGALC-------
A0A3Q3WIW8_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A219P0Y3_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q3MX20_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRIIGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      LHI--TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      LHI--TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      LHI--TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B4V3T1_BCL2L1-      LHI--TPATAYQSFANVMDEVFRDG-FNWGRIIGLFVFGGALC-------
A0A3B4XU17_BCL2L1-      LHI--TPATAYQSFANVMDEVFRDG-FNWGRIIGLFVFGGALC-------
A0A3P9MKK4_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3B3I2Q5_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3P9I2N4_BCL2L1-      LHI--TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC-------
A0A3B3QRZ2_BCL2L1-      LHI--TPVTAYQSFESVMNEVFRDG-INWGRIVGLFAFGGALC-------
A0A3B3ZMX9_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALA-------
G3NJY1_BCL2L1-01        LHI--TPATAYQSFEDVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      LHI--TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS-------
A0A3Q3DUT7_BCL2L1-      LHI--TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC-------
A0A3Q3DUT7_BCL2L1-      LHI--TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC-------
A0A3Q3DUT7_BCL2L1-      LHI--TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC-------
A0A3B1JJ42_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3P8UWG7_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIIGLFAFGGALS-------
A0A3Q3IVF5_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRIIGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P8TL99_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P8TL99_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q1FR00_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B4Z3X2_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B4Z3X2_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
C3VIT1_BCL2L1-01        LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P8P0F1_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q2X557_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P9D632_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P9D632_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q4N4B5_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B4FNX1_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q2QPL9_BCL2L1-      LHI--TPATAYQSFENVMNEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B5PQJ0_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A087X9B7_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B3TUS7_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3B3WI27_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3P9N9Y4_BCL2L1-      LHI--TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A3Q3BEB7_BCL2L1-      LDI--SPDTVYHSFKSVLDELFKDG-VNWGRVVGLFAFGGVLC-------
A0A3P8VMA1_BCL2L1-      LDL--TPDTVYHSFKSVMDEVFRDG-VNWGRIVGLFTFGGVLC-------
A0A345BSW9_BCL2L1-      LHI--TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC-------
A0A286MU87_BCL2L1-      LHI--TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3P8XFS0_BCL2L1-      LHI--TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A3P8XFS0_BCL2L1-      LHI--TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC-------
A0A0F7L1T6_BCL2L1-      LDI--TPDTAYQSFKNVMDEVFKDG-DNWGRVVGLFAFGGVLC-------
H2U5I3_BCL2L1-01        LDI--TPDTAYQSFKNVMDEVFKDG-VNWGRVVGLFAFGGVLC-------
H2U5I3_BCL2L1-02        LDI--TPDTAYQSFKNVMDEVFKDG-VNWGRVVGLFAFGGVLC-------
A0A3Q3J5K3_BCL2L1-      LVI--TPDTAYNSFKSVMDEVFKDG-VNWGRIVGLFAFGGALC-------
A0A3Q1EVP6_BCL2L1-      IDI--TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC-------
A0A3Q1BQA0_BCL2L1-      LDI--TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC-------
A0A3P8U812_BCL2L1-      LDI--TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC-------
E6ZFR0_BCL2L1-01        IDI--TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
G3P7B4_BCL2L1-01        LDV--TPDTAYHSFKSVMDEVFKDG-VNWGRVVGLFAFGGVLC-------
A0A3Q3X5M5_BCL2L1-      LDI--TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
A0A2U9BIG9_BCL2L1-      LDI--TPDTAYQSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC-------
                                 .   :   : :       .             *.       

A0A3Q1FR00_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQG-QGGW----
R4JQR8_BCL2L1-01        ---VKCVQRGMPQLVDS-----IVDWVSTYLCNSLEQWITD-NGGW----
A0A346RRN1_BCL2L1-      ---VECVQNGMPQLVDS-----IVDWVSVYLCDNLEPWITS-NGGW----
Q2TAP5_BCL2L1-01        ---VESANKEMTDLLPR-----IVQWMVNYLEHTLQPWMQE-NGGW----
Q91828_BCL2L1-01        ---VESANKEMTDLLPR-----IVQWMVNYLEHTLQPWMQE-NGGW----
I7GKS6_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5EBP4_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5Q6R6_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K6UWY8_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5M8B1_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5H963_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A2K5VPG2_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5YR37_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2R8Z9D7_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A096NV05_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K6QFA2_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A1U7T4L4_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQD-NGGW----
A0A2K6G3C5_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A3Q1LRT3_BCL2L1-      ---MKSIDKEIHVLVSQ-----VTTSTATYLNNHLKPWIQE-NGGW----
H9GHK7_BCL2L1-01        ---VESVDKEMQGLVVR-----IASWMTTYLTEHLDPWIQE-NGGW----
Q07816_BCL2L1-04        CCRAEEGPGDLQQMAPHRGDRGRSASAGIPAEPQVTPWLCPLAPGWLRLH
A0A493TIA6_BCL2L1-      ---VESVDKEMRVLVGR-----IVAWMTTYLSDHLDPWIQE-NGGW----
Q07816_BCL2L1-03        ---VESVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
Q07816_BCL2L1-02        ---VESVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
Q07816_BCL2L1-01        ---VESVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
G1N5N5_BCL2L1-01        ---VESVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
A0A452ILL8_BCL2L1-      ---VESVDKEMQVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
A0A452ILL8_BCL2L1-      ---VESVDKEMQVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW----
K7F655_BCL2L1-01        ---VESVDKEMQVLVGR-----IASWMTTYLTDHLDPWIQE-NGGW----
A0A452E1B1_BCL2L1-      ---MKSIVKEMQVLVSQ-----VTTWMATYLNNHLEPWIQE-NGDW----
W5PSA5_BCL2L1-01        ---MKSIVKEMQVLVSQ-----VTTWMATYLNDHLEPWIQE-NGDW----
P53563_BCL2L1-02        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
P53563_BCL2L1-03        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
A0A287CZ07_BCL2L1-      ---MESVDKEMQVLVSR-----IASWM---------PWIQE-NGGW----
A0A3Q2H0F6_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGWKETA
F6WA14_BCL2L1-01        ---VESVDKEMEVLVGR-----ITSWMATYLDDHLDPWIQE-NGGW----
G3WKX6_BCL2L1-01        ---VESVDKEMEVLVAR-----ITSWMATYLDEHLDPWIQE-NGGW----
M3XA94_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
M3XA94_BCL2L1-02        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
H0X6V2_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
G3SPN0_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q2PFS6_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
O35843_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
M3XA94_BCL2L1-03        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
G1RER8_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A1S2ZQT6_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q64373_BCL2L1-09        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
Q64373_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
P53563_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
O77737_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q9MYW4_BCL2L1-01        ---VESVDKEMEVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A3Q2H0F6_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
L8J061_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q05KJ0_BCL2L1-02        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q05KJ0_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
E2IV76_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A2K6G3C5_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
B2Z3Z4_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW----
G3HEA7_BCL2L1-02        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW----
G3HEA7_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW----
A0A1U7T4L4_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQD-NGGW----
M3Z2H9_BCL2L1-01        ---VESVDKEMQALVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A1U7QU73_BCL2L1-      ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW----
A0A0D9RJZ8_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A286Y5D6_BCL2L1-      ---VESVDKEMQVLVRR-----IASWMATYLNDHLEPWIQD-NGGW----
A0A250YD48_BCL2L1-      ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
A0A1L5BWY3_BCL2L1-      ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
I3MUP5_BCL2L1-01        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
I3MUP5_BCL2L1-02        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
I3MUP5_BCL2L1-03        ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW----
G1P9D2_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A2K5EBP4_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
E2IV75_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
F7IT34_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
Q76LT7_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5Q6R6_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5Q6R6_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5M8B1_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5H963_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q8SQ42_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5VPG2_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K5YR37_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2R8Z9D7_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A096NV05_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2J8VIH3_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K6QFA2_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K6QFA2_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A2K6UWY8_BCL2L1-      ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
E2IV77_BCL2L1-01        ---VESVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW----
A0A452SDS4_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A384D3U1_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
A0A452FWV3_BCL2L1-      ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
Q9MZS7_BCL2L1-01        ---VESVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW----
H3ANS8_BCL2L1-01        ---VESMDKEMSSLVER-----IAEWMTTYLDDNLNPWIQE-QGGW----
A0A452FHY1_BCL2L1-      ---MESVDKEMQVLVSQ-----VMTWMASQLNDHLEPWIQE-NGGW----
A0A452FHY1_BCL2L1-      ---MESVDKEMQVLVSQ-----VMTWMASQLNDHLEPWIQE-NGGW----
A0A1S3EPX7_BCL2L1-      ---VESVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-HGGW----
A0A218USB3_BCL2L1-      ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
H0Z8G3_BCL2L1-01        ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
A0A218USB3_BCL2L1-      ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
U3JSL7_BCL2L1-01        ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
A0A218USB3_BCL2L1-      ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
A0A218USB3_BCL2L1-      ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
Q4U2V6_BCL2L1-01        ---VESVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW----
D2ITA2_BCL2L1-02        ---VECVEKEMSHMVPR-----VAEWMTRYLDDHIDHWIQS-NGGW----
A0A3B3E2W4_BCL2L1-      ---VECVERNMSELVSR-----IAEWMTMYLDEQISPWIHS-QGGW----
A0A3B3I2Q5_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3P9I2N4_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3P9MKK4_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3B5B4X7_BCL2L1-      ---VECVDKNMNELVPR-----IADWMTMYLDEHISLWIQS-QGGW----
A0A3B4BFZ8_BCL2L1-      ---VECVEKDMSILVPR-----IANWMTIYLDENIATWIQN-QGGW----
A0A3Q3FUB6_BCL2L1-      ---VECVQKDMGELVSR-----IAGWMTTYLDEHISAWIES-QGGW----
A0A3B5MGS2_BCL2L1-      ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLSPWIQS-QGGW----
M4A558_BCL2L1-01        ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLSPWIQS-QGGW----
A0A3P9QFB3_BCL2L1-      ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW----
A0A087YBW4_BCL2L1-      ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW----
A0A3B3VWI7_BCL2L1-      ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW----
A0A3B3XN57_BCL2L1-      ---VDCVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW----
A0A3Q2C6K4_BCL2L1-      ---VHCVQKNMSELVSR-----IADWMTIYLDEQLNPWIHS-QGGW----
A0A3Q2NRP4_BCL2L1-      ---VDCVQKNMSELVPR-----IADWMTIYLDEQLDPWVRS-QGGW----
A0A0B4KJI5_BCL2L1-      ---VECVEKDTSELVSR-----IADWMTMYLDEHINPWIES-QGGW----
A0A3Q1JZ46_BCL2L1-      ---VECVEKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW----
A0A3Q1JZ46_BCL2L1-      ---VECVEKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW----
A0A3Q3NFM4_BCL2L1-      ---VECIEKNMSALVSR-----IADWMTMYLDEHISPWIES-QGGW----
A0A3Q3NFM4_BCL2L1-      ---VECIEKNMSALVSR-----IADWMTMYLDEHISPWIES-QGGW----
A0A3B4V9K8_BCL2L1-      ---VECIQKNMSELVSR-----ITDWMTMYLDEHISPWIQS-QGGW----
A0A3B4XS24_BCL2L1-      ---VECIQKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW----
C1BLI0_BCL2L1-01        ---AECVEKDMSHLVAR-----IADWMTTYLDNHIQPWIQR-QGGW----
C0HAD8_BCL2L1-01        ---VECVEKDMSPLVAR-----IADWMTTYLDNHIQPWIQS-QGGW----
A0A3B3ZMX9_BCL2L1-      ---VECVDKEMSTLVAR-----IVTWMTVYLDEHIQDWIDS-QGGW----
A0A3B5K6B9_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNHIQPWIQS-QGGW----
A0A3B5K6B9_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNHIQPWIQS-QGGW----
H3CH49_BCL2L1-01        ---VECVEKEMNPLVGR-----IIEWMTVYLDNHIQPWIQS-QGGW----
A0A3B3TFR4_BCL2L1-      ---VECVEKEMSPLVGH-----IVDWMTVYLDNHIQPWIQT-QGGW----
A0A3P8XYL5_BCL2L1-      ---VECVEKEMSPLVGR-----IADWMTVYLDNHIQPWIES-QGGW----
Q90Z98_BCL2L1-02        ---VECVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW----
Q90Z98_BCL2L1-01        ---VECVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW----
A0A059PJI5_BCL2L1-      ---VECVEKEMSPLVAR-----IAEWMTVYLDNHIQPWIEE-QGGW----
A0A3B4DTL9_BCL2L1-      ---VECVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQE-QGGW----
A0A3Q2FR43_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDEQIDPWIQS-QGGW----
B5XAY3_BCL2L1-01        ---VECVDKEMNPLVGR-----ITDWMTVYLDNHIQPWIQS-QGGW----
W5MG74_BCL2L1-01        ---VECVEKEMSNLVSR-----IAEWMTVYLDNNIQPWIQS-QGGW----
A0A2U9BY16_BCL2L1-      ---VECVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW----
A0A3Q3B3X5_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3B3IB64_BCL2L1-      ---VECVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3P9JYH1_BCL2L1-      ---VECVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3B3DHA1_BCL2L1-      ---VECVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q0RTF8_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
I3IZK7_BCL2L1-01        ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A2U9BY16_BCL2L1-      ---VECVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW----
A0A2U9BY16_BCL2L1-      ---VECVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW----
A0A2U9BY16_BCL2L1-      ---VECVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW----
A0A0D6DR75_BCL2L1-      ---VECVEKEMSQLVVR-----IVEWMTVYLDDHIQPWIQS-QGGW----
A0A3Q3WIW8_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNQIQPWIES-QGGW----
A0A219P0Y3_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWKTRYLDNHIQPWIQS-QRGW----
A0A3Q3MX20_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTLYLDNHIEPWIQS-QGGW----
A0A3Q3G2E1_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW----
A0A3Q3G2E1_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW----
A0A3Q3G2E1_BCL2L1-      ---VECVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW----
A0A3Q1GZ93_BCL2L1-      ---VECVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q1GZ93_BCL2L1-      ---VECVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q1GZ93_BCL2L1-      ---VECVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3B4V3T1_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNRIQPWIQS-QGGW----
A0A3B4XU17_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNRIQPWIQS-QGGW----
A0A3P9MKK4_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3B3I2Q5_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3P9I2N4_BCL2L1-      ---VECVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW----
A0A3B3QRZ2_BCL2L1-      ---VECVEKEMGHLVDR-----IADWMTVYLDSNIQPWIQR-QGGW----
A0A3B3ZMX9_BCL2L1-      ---VECVDKEMSTLVAR-----IVTWMTVYLDEHIQDWIDS-QGGW----
G3NJY1_BCL2L1-01        ---VECVDKEMSPLVGR-----IVEWMTLYLDNHIQPWIQN-QGGW----
A0A2U9BY16_BCL2L1-      ---VECVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW----
A0A3Q3DUT7_BCL2L1-      ---VECMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW----
A0A3Q3DUT7_BCL2L1-      ---VECMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW----
A0A3Q3DUT7_BCL2L1-      ---VECMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW----
A0A3B1JJ42_BCL2L1-      ---VECVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQE-QGGW----
A0A3P8UWG7_BCL2L1-      ---VECVEKEMSQLVAR-----IADWMTVYLDNHIQPWIET-QGGW----
A0A3Q3IVF5_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQG-QGGW----
A0A3Q1DHJ3_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3Q1DHJ3_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3Q1DHJ3_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3P8TL99_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3P8TL99_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3Q1FR00_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQG-QGGW----
A0A3B4Z3X2_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
A0A3B4Z3X2_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW----
C3VIT1_BCL2L1-01        ---VECVEREMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3P8P0F1_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q2X557_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3P9D632_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3P9D632_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q4N4B5_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3B4FNX1_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW----
A0A3Q2QPL9_BCL2L1-      ---VECVEKEMSPLVGR-----IVEWMTVYLDEQIDPWIQS-QGGW----
A0A3B5PQJ0_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDEQIEPWVES-QGGW----
A0A087X9B7_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW----
A0A3B3TUS7_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW----
A0A3B3WI27_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW----
A0A3P9N9Y4_BCL2L1-      ---VECVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW----
A0A3Q3BEB7_BCL2L1-      ---VQCVERDMSELVSR-----IADWMTVYLDEQIGPWIDS-QGGW----
A0A3P8VMA1_BCL2L1-      ---VECVQRNMSELVPR-----IADWMTMYLDEYIDPWIQS-QGGW----
A0A345BSW9_BCL2L1-      ---VECVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW----
A0A286MU87_BCL2L1-      ---VECVEKDMSPLVAR-----IADWMTTYLDNHIQPWIQS-QGGW----
A0A3P8XFS0_BCL2L1-      ---VECVEKDMSLLVAR-----IADWMTTYLDEHIQPWIQI-QGGW----
A0A3P8XFS0_BCL2L1-      ---VECVEKDMSLLVAR-----IADWMTTYLDEHIQPWIQI-QGGW----
A0A0F7L1T6_BCL2L1-      ---VECVERDASQLVCR-----IADWMTIYLDEHINPWIQS-QGGW----
H2U5I3_BCL2L1-01        ---VECVEKDASQLVCR-----IADWMTIYLDEHINPWIQS-QGGW----
H2U5I3_BCL2L1-02        ---VECVEKDASQLVCR-----IADWMTIYLDEHINPWIQS-QGGW----
A0A3Q3J5K3_BCL2L1-      ---VECVEKNMSELVSR-----IADWMTMYLDEHISPWIQN-QGGW----
A0A3Q1EVP6_BCL2L1-      ---VECVEKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGDW----
A0A3Q1BQA0_BCL2L1-      ---VECVEKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGGW----
A0A3P8U812_BCL2L1-      ---VECVDKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGGW----
E6ZFR0_BCL2L1-01        ---VECVEKDMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW----
G3P7B4_BCL2L1-01        ---VECVEKDMTELVSR-----IADWMTTYLDEHISAWIQS-QGGW----
A0A3Q3X5M5_BCL2L1-      ---VECAEKDTGELVCR-----IADWMTTYLDEHINPWIQS-QGGW----
A0A2U9BIG9_BCL2L1-      ---VECVEKNRGELVAR-----IADWMTMYLDEHISPWIQS-QGGW----
                                     :                       *:     .*    

A0A3Q1FR00_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
R4JQR8_BCL2L1-01        --------QG---FVE-----------------AYNQ-------------
A0A346RRN1_BCL2L1-      --------QG---FVE-----------------YYNQ-------------
Q2TAP5_BCL2L1-01        --------EA---FVG-----------------LYGK-----------NA
Q91828_BCL2L1-01        --------EA---FVG-----------------LYGK-----------NA
I7GKS6_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A2K5EBP4_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5Q6R6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6UWY8_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5M8B1_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5H963_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5VPG2_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5YR37_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2R8Z9D7_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A096NV05_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6QFA2_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A1U7T4L4_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6G3C5_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A3Q1LRT3_BCL2L1-      --------DT---FVE-----------------LYES-----------NT
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        TSTTQLPSTI--------------------------------------TI
A0A493TIA6_BCL2L1-      --------VRGCSFCT-----------------PLGDLGWIWPLSALQIT
Q07816_BCL2L1-03        --------ER---FVD-----------------LYGN-----------NA
Q07816_BCL2L1-02        --------ER---FVD-----------------LYGN-----------NA
Q07816_BCL2L1-01        --------ER---FVD-----------------LYGN-----------NA
G1N5N5_BCL2L1-01        --------ER---FVD-----------------LYGN-----------NA
A0A452ILL8_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
A0A452ILL8_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
K7F655_BCL2L1-01        --------ER---FVD-----------------LYGN-----------DA
A0A452E1B1_BCL2L1-      --------DI---FVE-----------------LYEN-----------NT
W5PSA5_BCL2L1-01        --------DI---FVE-----------------LYEN-----------NT
P53563_BCL2L1-02        --------VR---TTP-----------------LVCP-----------PL
P53563_BCL2L1-03        --------VR---TTP-----------------LVCP-----------PL
A0A287CZ07_BCL2L1-      --------DT---FVE-----------------LYRN-----------NA
A0A3Q2H0F6_BCL2L1-      LGTFCYFVSS---LMR-----------------LSGQ-----------GG
F6WA14_BCL2L1-01        --------DT---FVE-----------------LYGN-----------DA
G3WKX6_BCL2L1-01        --------DT---FVE-----------------LYGN-----------DA
M3XA94_BCL2L1-01        -----VVIEH-----Q-----------------RCAR-----------LC
M3XA94_BCL2L1-02        --------DT---FVE-----------------LYGN-----------NA
H0X6V2_BCL2L1-01        -----WRCQA---FPE-----------------LLSP-----------KS
G3SPN0_BCL2L1-01        --------VR---TTP-----------------LLCF-----------ST
Q2PFS6_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
O35843_BCL2L1-01        --------GV----------------------------------------
M3XA94_BCL2L1-03        --------VW---TGL-----------------FYPE-----------FL
G1RER8_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A1S2ZQT6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
Q64373_BCL2L1-09        --------DT---FVD-----------------LYGN-----------NA
Q64373_BCL2L1-01        --------DT---FVD-----------------LYGN-----------NA
P53563_BCL2L1-01        --------DT---FVD-----------------LYGN-----------NA
O77737_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
Q9MYW4_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A3Q2H0F6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
L8J061_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
Q05KJ0_BCL2L1-02        --------DT---FVE-----------------LYGN-----------NA
Q05KJ0_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
E2IV76_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A2K6G3C5_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
B2Z3Z4_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
G3HEA7_BCL2L1-02        --------DT---FVE-----------------LYGN-----------NA
G3HEA7_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A1U7T4L4_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
M3Z2H9_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A1U7QU73_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A0D9RJZ8_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A286Y5D6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A250YD48_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A1L5BWY3_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
I3MUP5_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
I3MUP5_BCL2L1-02        --------DT---FVE-----------------LYGN-----------NA
I3MUP5_BCL2L1-03        --------DT---FVE-----------------LYGN-----------NA
G1P9D2_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A2K5EBP4_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
E2IV75_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
F7IT34_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
Q76LT7_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A2K5Q6R6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5Q6R6_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5M8B1_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5H963_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
Q8SQ42_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A2K5VPG2_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K5YR37_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2R8Z9D7_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A096NV05_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2J8VIH3_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6QFA2_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6QFA2_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A2K6UWY8_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
E2IV77_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
A0A452SDS4_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A384D3U1_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A452FWV3_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
Q9MZS7_BCL2L1-01        --------DT---FVE-----------------LYGN-----------NA
H3ANS8_BCL2L1-01        --------AT---IIH-----------------IDGV-----------DA
A0A452FHY1_BCL2L1-      --------DT---SVE-----------------FCEN-----------NT
A0A452FHY1_BCL2L1-      --------DT---SVE-----------------FCEN-----------NT
A0A1S3EPX7_BCL2L1-      --------DT---FVE-----------------LYGN-----------NA
A0A218USB3_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
H0Z8G3_BCL2L1-01        --------ER---FVD-----------------SM-N-----------DA
A0A218USB3_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
U3JSL7_BCL2L1-01        --------ER---FVD-----------------LYGN-----------DA
A0A218USB3_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
A0A218USB3_BCL2L1-      --------ER---FVD-----------------LYGN-----------DA
Q4U2V6_BCL2L1-01        --------ER---FVD-----------------LYGN-----------DA
D2ITA2_BCL2L1-02        --------KH---FAA-----------------VFGS-----------DA
A0A3B3E2W4_BCL2L1-      --------DC---FAQ-----------------LYGQ-----------DG
A0A3B3I2Q5_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3P9I2N4_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3P9MKK4_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3B5B4X7_BCL2L1-      --------EC---FAE-----------------IFGQ-----------DA
A0A3B4BFZ8_BCL2L1-      --------AS---FAQ-----------------IFGQ-----------NA
A0A3Q3FUB6_BCL2L1-      --------DC---FVE-----------------IFGR-----------GA
A0A3B5MGS2_BCL2L1-      --------DR---FAN-----------------LYGQ-----------DA
M4A558_BCL2L1-01        --------DR---FAN-----------------LYGQ-----------DA
A0A3P9QFB3_BCL2L1-      --------DH---FAN-----------------LYGQ-----------DA
A0A087YBW4_BCL2L1-      --------DR---FAN-----------------LYGQ-----------DA
A0A3B3VWI7_BCL2L1-      --------DR---FAN-----------------LYGQ-----------DA
A0A3B3XN57_BCL2L1-      --------DR---FAN-----------------LYGQ-----------DA
A0A3Q2C6K4_BCL2L1-      --------DC---FAK-----------------LYGQ-----------DA
A0A3Q2NRP4_BCL2L1-      --------EC---FAK-----------------LYGQ-----------DA
A0A0B4KJI5_BCL2L1-      --------DS---FAE-----------------VFGR-----------DA
A0A3Q1JZ46_BCL2L1-      --------DC---FAE-----------------IFGQ-----------DA
A0A3Q1JZ46_BCL2L1-      --------DC---FAE-----------------IFGQ-----------DA
A0A3Q3NFM4_BCL2L1-      --------DC---FAE-----------------IFGR-----------DA
A0A3Q3NFM4_BCL2L1-      --------DC---FAE-----------------IFGR-----------DA
A0A3B4V9K8_BCL2L1-      --------DC---FAE-----------------MFGQ-----------DA
A0A3B4XS24_BCL2L1-      --------DC---FAE-----------------MFGQ-----------DA
C1BLI0_BCL2L1-01        --------DR---FAD-----------------IFGR-----------DA
C0HAD8_BCL2L1-01        --------DR---FAE-----------------IFGR-----------DA
A0A3B3ZMX9_BCL2L1-      --------AR---FAE-----------------IYGQ-----------DA
A0A3B5K6B9_BCL2L1-      --------VR---FAE-----------------LFGQ-----------DA
A0A3B5K6B9_BCL2L1-      --------VR---FAE-----------------LFGQ-----------DA
H3CH49_BCL2L1-01        --------ER---FAE-----------------LFGQ-----------DA
A0A3B3TFR4_BCL2L1-      --------DR---FAE-----------------IFGN-----------DA
A0A3P8XYL5_BCL2L1-      --------DR---FAE-----------------IFGK-----------DA
Q90Z98_BCL2L1-02        --------ER---FAE-----------------IFGK-----------DA
Q90Z98_BCL2L1-01        --------ER---FAE-----------------IFGK-----------DA
A0A059PJI5_BCL2L1-      --------ER---FAE-----------------IFGK-----------DA
A0A3B4DTL9_BCL2L1-      --------ER---FAE-----------------IFGK-----------DA
A0A3Q2FR43_BCL2L1-      --------ER---FAE-----------------IFGG-----------DA
B5XAY3_BCL2L1-01        --------DR---FAE-----------------IFGM-----------DA
W5MG74_BCL2L1-01        --------DR---FAE-----------------IFGK-----------DA
A0A2U9BY16_BCL2L1-      --------TF---CHQTTRPVKPRKMKMPPRTVFHSA-----------DG
A0A3Q3B3X5_BCL2L1-      --------ER---FAE-----------------IFGD-----------NA
A0A3B3IB64_BCL2L1-      --------ER---FAE-----------------IFGQ-----------EA
A0A3P9JYH1_BCL2L1-      --------ER---FAE-----------------IFGQ-----------EA
A0A3B3DHA1_BCL2L1-      --------ER---FAE-----------------IFGQ-----------EA
A0A3Q0RTF8_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
I3IZK7_BCL2L1-01        --------ER---FAE-----------------IFGQ-----------DA
A0A2U9BY16_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A2U9BY16_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A2U9BY16_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A0D6DR75_BCL2L1-      --------EH---FAE-----------------IFGH-----------DA
A0A3Q3WIW8_BCL2L1-      --------QR---FAE-----------------IFGQ-----------DA
A0A219P0Y3_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q3MX20_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A3Q3G2E1_BCL2L1-      --------ER---FSE-----------------IFGQ-----------DA
A0A3Q3G2E1_BCL2L1-      --------ER---FSE-----------------IFGQ-----------DA
A0A3Q3G2E1_BCL2L1-      --------ER---FSE-----------------IFGQ-----------DA
A0A3Q1GZ93_BCL2L1-      --------ER---FAE-----------------LFGH-----------DA
A0A3Q1GZ93_BCL2L1-      --------ER---FAE-----------------LFGH-----------DA
A0A3Q1GZ93_BCL2L1-      --------ER---FAE-----------------LFGH-----------DA
A0A3B4V3T1_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3B4XU17_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3P9MKK4_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3B3I2Q5_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3P9I2N4_BCL2L1-      --------DC---FAR-----------------LYGQ-----------NG
A0A3B3QRZ2_BCL2L1-      --------DR---FAE-----------------IFGK-----------DA
A0A3B3ZMX9_BCL2L1-      --------AR---FAE-----------------IYGQ-----------DA
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A3Q3DUT7_BCL2L1-      --------QR---FAE-----------------IFGH-----------DA
A0A3Q3DUT7_BCL2L1-      --------QR---FAE-----------------IFGH-----------DA
A0A3Q3DUT7_BCL2L1-      --------QR---FAE-----------------IFGH-----------DA
A0A3B1JJ42_BCL2L1-      --------ER---FAE-----------------IFGN-----------DT
A0A3P8UWG7_BCL2L1-      --------EH---FAE-----------------LFGQ-----------DA
A0A3Q3IVF5_BCL2L1-      --------ER---FAE-----------------LFGQ-----------DA
A0A3Q1DHJ3_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q1DHJ3_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q1DHJ3_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3P8TL99_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3P8TL99_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q1FR00_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3B4Z3X2_BCL2L1-      --------DR---FAE-----------------IFGQ-----------DA
A0A3B4Z3X2_BCL2L1-      --------DR---FAE-----------------IFGQ-----------DA
C3VIT1_BCL2L1-01        --------ER---FAE-----------------IFGQ-----------DA
A0A3P8P0F1_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q2X557_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3P9D632_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3P9D632_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q4N4B5_BCL2L1-      --------EH---FAE-----------------IFGQ-----------DA
A0A3B4FNX1_BCL2L1-      --------ER---FAE-----------------IFGQ-----------DA
A0A3Q2QPL9_BCL2L1-      --------ER---FAE-----------------IFGG-----------NA
A0A3B5PQJ0_BCL2L1-      --------ER---FAE-----------------IFGG-----------NA
A0A087X9B7_BCL2L1-      --------DR---FAE-----------------IFGG-----------NA
A0A3B3TUS7_BCL2L1-      --------DR---FAE-----------------IFGG-----------NA
A0A3B3WI27_BCL2L1-      --------DR---FAE-----------------IFGG-----------NA
A0A3P9N9Y4_BCL2L1-      --------ER---FAE-----------------IFGG-----------NA
A0A3Q3BEB7_BCL2L1-      --------DS---FAE-----------------MYGR-----------DA
A0A3P8VMA1_BCL2L1-      --------DR---FAE-----------------IFGT-----------DC
A0A345BSW9_BCL2L1-      ---------------------------------VSGK-------------
A0A286MU87_BCL2L1-      --------------AE-----------------IFGR-----------DA
A0A3P8XFS0_BCL2L1-      --------DR---FAD-----------------IFGR-----------DA
A0A3P8XFS0_BCL2L1-      --------DR---FAD-----------------IFGR-----------DA
A0A0F7L1T6_BCL2L1-      --------DC---FAK-----------------IFGD-----------DA
H2U5I3_BCL2L1-01        --------DC---FAK-----------------IFGD-----------DA
H2U5I3_BCL2L1-02        --------DC---FAK-----------------IFGD-----------DA
A0A3Q3J5K3_BCL2L1-      --------DC---FAE-----------------IFGR-----------DN
A0A3Q1EVP6_BCL2L1-      --------EC---FAE-----------------IFGQ-----------NA
A0A3Q1BQA0_BCL2L1-      --------EC---FAE-----------------IFGQ-----------NA
A0A3P8U812_BCL2L1-      --------EC---FAE-----------------IFGQ-----------NA
E6ZFR0_BCL2L1-01        --------DC---FAE-----------------VFGR-----------DA
G3P7B4_BCL2L1-01        --------DC---FAD-----------------IFGR-----------DG
A0A3Q3X5M5_BCL2L1-      --------GC---FAE-----------------VFGH-----------NA
A0A2U9BIG9_BCL2L1-      --------GC---FAE-----------------IFGQ-----------GA
                                                                          

A0A3Q1FR00_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
R4JQR8_BCL2L1-01        ---GQNHNDS---------P--------------------------WD--
A0A346RRN1_BCL2L1-      ---AQNHNDN---------Q--------------------------WN--
Q2TAP5_BCL2L1-01        AAQSRESQER------FG-R------------------------------
Q91828_BCL2L1-01        AAQSRESQER------FG-R------------------------------
I7GKS6_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A2K5EBP4_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5Q6R6_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6UWY8_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5M8B1_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5H963_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5VPG2_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5YR37_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2R8Z9D7_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A096NV05_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6QFA2_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A1U7T4L4_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6G3C5_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A3Q1LRT3_BCL2L1-      TNESQKGQER------FN-C--------------------------WS--
H9GHK7_BCL2L1-01        -------------------K------------------------------
Q07816_BCL2L1-04        TGRSPRSTEL------PSSR--------------------------RQ--
A0A493TIA6_BCL2L1-      PPPRPPPPRT------PP-R--------------------------PL--
Q07816_BCL2L1-03        AAELRKGQET------FN-K--------------------------WL--
Q07816_BCL2L1-02        AAELRKGQET------FN-K--------------------------WL--
Q07816_BCL2L1-01        AAELRKGQET------FN-K--------------------------WL--
G1N5N5_BCL2L1-01        AAELRKGQET------FN-K--------------------------WL--
A0A452ILL8_BCL2L1-      AAKSRKGQEQ------FN-R--------------------------WL--
A0A452ILL8_BCL2L1-      AAKSRKGQEQ------FN-R--------------------------WL--
K7F655_BCL2L1-01        AAKSRKGQEQ------FN-R--------------------------GL--
A0A452E1B1_BCL2L1-      ATESQKGQEH------FN-R--------------------------WS--
W5PSA5_BCL2L1-01        ATESQKGQEH------LN-R--------------------------WS--
P53563_BCL2L1-02        VCLSSVEIPN------CP----------------------------FW--
P53563_BCL2L1-03        VCLSSVEIPN------CP----------------------------FW--
A0A287CZ07_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A3Q2H0F6_BCL2L1-      ALQLAPSYSA------F-----------------------------WADS
F6WA14_BCL2L1-01        AAESRKGQER------FN-R--------------------------WL--
G3WKX6_BCL2L1-01        AAESRKGQER------FN-R--------------------------WL--
M3XA94_BCL2L1-01        APQGAHSPEQ------SS-P--------------------------WSTS
M3XA94_BCL2L1-02        AAESRKGQVR------TNAETELPQRVCPVLGTTPCLDFAGTGRDCWPGR
H0X6V2_BCL2L1-01        NS-----------------I--------------------------YFKV
G3SPN0_BCL2L1-01        SVKEDIAYVF------IQVK--------------------------TY--
Q2PFS6_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
O35843_BCL2L1-01        -----SGGTP------LR-S--------------------------VF--
M3XA94_BCL2L1-03        AQGLRLGK------------------------------------------
G1RER8_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A1S2ZQT6_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
Q64373_BCL2L1-09        AAESRKGQER------FN-R--------------------------WF--
Q64373_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
P53563_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
O77737_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
Q9MYW4_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A3Q2H0F6_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
L8J061_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
Q05KJ0_BCL2L1-02        AAESRKGQER------FN-R--------------------------WF--
Q05KJ0_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
E2IV76_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A2K6G3C5_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
B2Z3Z4_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
G3HEA7_BCL2L1-02        AAESRKGQER------FN-R--------------------------WF--
G3HEA7_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A1U7T4L4_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
M3Z2H9_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A1U7QU73_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A0D9RJZ8_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A286Y5D6_BCL2L1-      AAESRKGQER------FN-R--------------------------WL--
A0A250YD48_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A1L5BWY3_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
I3MUP5_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
I3MUP5_BCL2L1-02        AAESRKGQER------FN-R--------------------------WF--
I3MUP5_BCL2L1-03        AAESRKGQER------FN-R--------------------------WF--
G1P9D2_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A2K5EBP4_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
E2IV75_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
F7IT34_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
Q76LT7_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A2K5Q6R6_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5Q6R6_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5M8B1_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5H963_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
Q8SQ42_BCL2L1-01        AAESRKGQER------SN-R--------------------------WF--
A0A2K5VPG2_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K5YR37_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2R8Z9D7_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A096NV05_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2J8VIH3_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6QFA2_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6QFA2_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A2K6UWY8_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
E2IV77_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
A0A452SDS4_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A384D3U1_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A452FWV3_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
Q9MZS7_BCL2L1-01        AAESRKGQER------FN-R--------------------------WF--
H3ANS8_BCL2L1-01        MQRSNTRSEKLGFVGFFF-S--------------------------FL--
A0A452FHY1_BCL2L1-      ATESQKGQER------FN-C--------------------------WS--
A0A452FHY1_BCL2L1-      ATESQKGQER------FN-C--------------------------WS--
A0A1S3EPX7_BCL2L1-      AAESRKGQER------FN-R--------------------------WF--
A0A218USB3_BCL2L1-      AAEMRKGQET------FN-K--------------------------WL--
H0Z8G3_BCL2L1-01        AAEMRKGQE-------FN-K--------------------------WL--
A0A218USB3_BCL2L1-      AAEMRKGQET------FN-K--------------------------WL--
U3JSL7_BCL2L1-01        AAEVRKGQET------FN-K--------------------------WL--
A0A218USB3_BCL2L1-      AAEMRKGQET------FN-K--------------------------WL--
A0A218USB3_BCL2L1-      AAEMRKGQET------FN-K--------------------------WL--
Q4U2V6_BCL2L1-01        AAEMRKGQET------FN-K--------------------------WL--
D2ITA2_BCL2L1-02        AAGARRTRDS------HR-R--------------------------WM--
A0A3B3E2W4_BCL2L1-      AAEARRFQET------LK-K--------------------------WT--
A0A3B3I2Q5_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3P9I2N4_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3P9MKK4_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3B5B4X7_BCL2L1-      AAEARRSRDS------LK-R--------------------------WL--
A0A3B4BFZ8_BCL2L1-      AGEARRSRET------LK-K--------------------------WL--
A0A3Q3FUB6_BCL2L1-      VGEVRRSRET------LT-R--------------------------WL--
A0A3B5MGS2_BCL2L1-      AAEGRRFRET------LN-K--------------------------WL--
M4A558_BCL2L1-01        AAEGRRFRET------LN-K--------------------------WL--
A0A3P9QFB3_BCL2L1-      AAEGRRFRET------LN-K--------------------------WL--
A0A087YBW4_BCL2L1-      AAEGRRFRET------LN-K--------------------------WL--
A0A3B3VWI7_BCL2L1-      AAEGRRFRET------LN-K--------------------------WL--
A0A3B3XN57_BCL2L1-      AAEGRRFRET------LN-K--------------------------WL--
A0A3Q2C6K4_BCL2L1-      AAEGRRSHET------LN-K--------------------------WL--
A0A3Q2NRP4_BCL2L1-      AAAGRRFQET------LN-K--------------------------WL--
A0A0B4KJI5_BCL2L1-      AAEARRSRET------LS-R--------------------------WL--
A0A3Q1JZ46_BCL2L1-      AAEARRSREA------LR-R--------------------------WL--
A0A3Q1JZ46_BCL2L1-      AAEARRSREA------LR-R--------------------------WL--
A0A3Q3NFM4_BCL2L1-      AAEARRSQET------LR-R--------------------------WL--
A0A3Q3NFM4_BCL2L1-      AAEARRSQET------LR-R--------------------------WL--
A0A3B4V9K8_BCL2L1-      AAEARRSREA------VM-K--------------------------WL--
A0A3B4XS24_BCL2L1-      AAEARRSREA------VR-R--------------------------WL--
C1BLI0_BCL2L1-01        AAEVRRSQEN------LR-R--------------------------WL--
C0HAD8_BCL2L1-01        AADVRRSQES------II-K--------------------------WL--
A0A3B3ZMX9_BCL2L1-      AAQSRHSEER------FK-K--------------------------WL--
A0A3B5K6B9_BCL2L1-      AAESRRSQER------FR-N--------------------------GL--
A0A3B5K6B9_BCL2L1-      AAESRRSQER------FR-N--------------------------GL--
H3CH49_BCL2L1-01        AAESRRSQER------FR-N--------------------------GL--
A0A3B3TFR4_BCL2L1-      AAEGRRSRER------FQ-Q--------------------------WL--
A0A3P8XYL5_BCL2L1-      AANSRKSQES------FK-K--------------------------WL--
Q90Z98_BCL2L1-02        AAESRKSQES------FK-K--------------------------WL--
Q90Z98_BCL2L1-01        AAESRKSQES------FK-K--------------------------WL--
A0A059PJI5_BCL2L1-      AAEGRRSQES------FK-K--------------------------WL--
A0A3B4DTL9_BCL2L1-      AAESRRSQEN------FK-K--------------------------WL--
A0A3Q2FR43_BCL2L1-      AAESRRSQES------LK-N--------------------------WL--
B5XAY3_BCL2L1-01        AAESRKSQES------FK-K--------------------------WL--
W5MG74_BCL2L1-01        AAEYRRSQES------FK-K--------------------------WL--
A0A2U9BY16_BCL2L1-      SCISGKVWQN------LS-R--------------------------YT--
A0A3Q3B3X5_BCL2L1-      AAESRISQEG------LK-K--------------------------WL--
A0A3B3IB64_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3P9JYH1_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3B3DHA1_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q0RTF8_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
I3IZK7_BCL2L1-01        AAESRRSQES------FK-K--------------------------WL--
A0A2U9BY16_BCL2L1-      AAGSRRSQES------FK-K--------------------------WL--
A0A2U9BY16_BCL2L1-      AAGSRRSQES------FK-K--------------------------WL--
A0A2U9BY16_BCL2L1-      AAGSRRSQES------FK-K--------------------------WL--
A0A0D6DR75_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q3WIW8_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A219P0Y3_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q3MX20_BCL2L1-      AAESRRSQEN------FK-K--------------------------WL--
A0A3Q3G2E1_BCL2L1-      AGEIRRSQES------FK-K--------------------------WL--
A0A3Q3G2E1_BCL2L1-      AGEIRRSQES------FK-K--------------------------WL--
A0A3Q3G2E1_BCL2L1-      AGEIRRSQES------FK-K--------------------------WL--
A0A3Q1GZ93_BCL2L1-      AAEGRRSQES------FK-K--------------------------WL--
A0A3Q1GZ93_BCL2L1-      AAEGRRSQES------FK-K--------------------------WL--
A0A3Q1GZ93_BCL2L1-      AAEGRRSQES------FK-K--------------------------WL--
A0A3B4V3T1_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3B4XU17_BCL2L1-      AADSRRSQES------FK-K--------------------------WL--
A0A3P9MKK4_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3B3I2Q5_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3P9I2N4_BCL2L1-      AAEARRFQET------LK-K--------------------------WM--
A0A3B3QRZ2_BCL2L1-      AAESRRSQEN------FK-K--------------------------WL--
A0A3B3ZMX9_BCL2L1-      AAQSRHSEER------FK-K--------------------------WL--
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      AAGSRRSQES------FK-K--------------------------WL--
A0A3Q3DUT7_BCL2L1-      AAEVRRSQES------FK-K--------------------------WL--
A0A3Q3DUT7_BCL2L1-      AAEVRRSQES------FK-K--------------------------WL--
A0A3Q3DUT7_BCL2L1-      AAEVRRSQES------FK-K--------------------------WL--
A0A3B1JJ42_BCL2L1-      AAESRRMQER------YK-M--------------------------WL--
A0A3P8UWG7_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q3IVF5_BCL2L1-      AAENRRSQES------FK-K--------------------------WL--
A0A3Q1DHJ3_BCL2L1-      AAESRKSQES------FK-K--------------------------WL--
A0A3Q1DHJ3_BCL2L1-      AAESRKSQES------FK-K--------------------------WL--
A0A3Q1DHJ3_BCL2L1-      AAESRKSQES------FK-K--------------------------WL--
A0A3P8TL99_BCL2L1-      AAESRKSQES------FK-K--------------------------WL--
A0A3P8TL99_BCL2L1-      AAESRKSQES------FK-K--------------------------WL--
A0A3Q1FR00_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3B4Z3X2_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3B4Z3X2_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
C3VIT1_BCL2L1-01        AAESRRSQES------FK-K--------------------------WL--
A0A3P8P0F1_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q2X557_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3P9D632_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3P9D632_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q4N4B5_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3B4FNX1_BCL2L1-      AAESRRSQES------FK-K--------------------------WL--
A0A3Q2QPL9_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A3B5PQJ0_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A087X9B7_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A3B3TUS7_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A3B3WI27_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A3P9N9Y4_BCL2L1-      AAESRRSQES------FK-N--------------------------WL--
A0A3Q3BEB7_BCL2L1-      AAEARRFQES------LK-K--------------------------WL--
A0A3P8VMA1_BCL2L1-      IPRTRSCRDT------VR-R--------------------------WL--
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      AADVRRSQES------II-K--------------------------WL--
A0A3P8XFS0_BCL2L1-      AADIRRSQES------LR-K--------------------------WL--
A0A3P8XFS0_BCL2L1-      AADIRRSQES------LR-K--------------------------WL--
A0A0F7L1T6_BCL2L1-      AAEGRRAREN------LS-R--------------------------WM--
H2U5I3_BCL2L1-01        AAEGRRAREN------LS-R--------------------------WM--
H2U5I3_BCL2L1-02        AAEGRRAREN------LS-R--------------------------WM--
A0A3Q3J5K3_BCL2L1-      AAEVRRSQET------LR-R--------------------------WL--
A0A3Q1EVP6_BCL2L1-      AAEARRSRDT------LK-R--------------------------WL--
A0A3Q1BQA0_BCL2L1-      AAEARRSRDT------LK-R--------------------------WL--
A0A3P8U812_BCL2L1-      AAEARRSRDT------LK-R--------------------------WL--
E6ZFR0_BCL2L1-01        AAEARRSRET------LS-R--------------------------WL--
G3P7B4_BCL2L1-01        AAAARRSQET------MR-R--------------------------WL--
A0A3Q3X5M5_BCL2L1-      AAEARRSQET------LN-R--------------------------WL--
A0A2U9BIG9_BCL2L1-      GAEARRYRES------VR-R--------------------------WL--
                                                                          

A0A3Q1FR00_BCL2L1-      -----LVG-------------------------MTVVTG-----------
R4JQR8_BCL2L1-01        -----VKG-------------------LVKYGAIGVIGA-----------
A0A346RRN1_BCL2L1-      -----LGE-------------------FVRYGAIGVVGA-----------
Q2TAP5_BCL2L1-01        -----LLT-------------------------IVILTG-----------
Q91828_BCL2L1-01        -----LLT-------------------------IVMLTG-----------
I7GKS6_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A2K5EBP4_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5Q6R6_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6UWY8_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5M8B1_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5H963_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5VPG2_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5YR37_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2R8Z9D7_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A096NV05_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6QFA2_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A1U7T4L4_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6G3C5_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A3Q1LRT3_BCL2L1-      ----LTTR-------------------------LWLFGI-----------
H9GHK7_BCL2L1-01        -----SKG-------------------------GQIISV-----------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      -----PLP-------------------------PSLPPS-----------
Q07816_BCL2L1-03        -----LTG-------------------------ATVAGV-----------
Q07816_BCL2L1-02        -----LTG-------------------------ATVAGV-----------
Q07816_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
G1N5N5_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
A0A452ILL8_BCL2L1-      -----LTG-------------------------ATLAGV-----------
A0A452ILL8_BCL2L1-      -----LTG-------------------------ATLAGV-----------
K7F655_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
A0A452E1B1_BCL2L1-      -----LTD-------------------------VTVAGM-----------
W5PSA5_BCL2L1-01        -----LTD-------------------------MTVAGM-----------
P53563_BCL2L1-02        -----SPG-------------------------MVVEDIDYSGDIPGFTL
P53563_BCL2L1-03        -----SPG-------------------------MVVEDIDYSGDIPGFTL
A0A287CZ07_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A3Q2H0F6_BCL2L1-      RAPLGTRG-------------------------FSLALQ-----------
F6WA14_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
G3WKX6_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
M3XA94_BCL2L1-01        SRERRHDG-------------------------QGNKQD-----------
M3XA94_BCL2L1-02        WRKPPLGG-------------------------SDHSAQ-----------
H0X6V2_BCL2L1-01        CMCGNFCS-------------------------LAAAGR-----------
G3SPN0_BCL2L1-01        -----ASG-------------------------KLVQCF-----------
Q2PFS6_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
O35843_BCL2L1-01        -----RRL-------------------------VQVPGV-----------
M3XA94_BCL2L1-03        -------G-------------------------LASICS-----------
G1RER8_BCL2L1-01        -----LTG------------------------------------------
A0A1S2ZQT6_BCL2L1-      -----LTG-------------------------VTVAGL-----------
Q64373_BCL2L1-09        -----LTG-------------------------MTVAGV-----------
Q64373_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
P53563_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
O77737_BCL2L1-01        -----LTG-------------------------MTLAGV-----------
Q9MYW4_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A3Q2H0F6_BCL2L1-      -----LTG-------------------------MTVAGV-----------
L8J061_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
Q05KJ0_BCL2L1-02        -----LTG-------------------------MTVAGV-----------
Q05KJ0_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
E2IV76_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A2K6G3C5_BCL2L1-      -----LTG-------------------------MTVAGV-----------
B2Z3Z4_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
G3HEA7_BCL2L1-02        -----LTG-------------------------MTVAGV-----------
G3HEA7_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A1U7T4L4_BCL2L1-      -----LTG-------------------------MTVAGV-----------
M3Z2H9_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A1U7QU73_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A0D9RJZ8_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A286Y5D6_BCL2L1-      -----LTG-------------------------VTVAGV-----------
A0A250YD48_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A1L5BWY3_BCL2L1-      -----LTG-------------------------MTVAGV-----------
I3MUP5_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
I3MUP5_BCL2L1-02        -----LTG-------------------------MTVAGV-----------
I3MUP5_BCL2L1-03        -----LTG-------------------------MTVAGV-----------
G1P9D2_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A2K5EBP4_BCL2L1-      -----LTG-------------------------MTVAGV-----------
E2IV75_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
F7IT34_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
Q76LT7_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A2K5Q6R6_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5Q6R6_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5M8B1_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5H963_BCL2L1-      -----LTG-------------------------MTVAGV-----------
Q8SQ42_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A2K5VPG2_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K5YR37_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2R8Z9D7_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A096NV05_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2J8VIH3_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6QFA2_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6QFA2_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A2K6UWY8_BCL2L1-      -----LTG-------------------------MTVAGV-----------
E2IV77_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
A0A452SDS4_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A384D3U1_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A452FWV3_BCL2L1-      -----LTG-------------------------MTVAGV-----------
Q9MZS7_BCL2L1-01        -----LTG-------------------------MTVAGV-----------
H3ANS8_BCL2L1-01        -----LRG-------------------------VERNLK-----------
A0A452FHY1_BCL2L1-      -----LTA-------------------------VTLA-------------
A0A452FHY1_BCL2L1-      -----LTA-------------------------VTLAGG-----------
A0A1S3EPX7_BCL2L1-      -----LTG-------------------------MTVAGV-----------
A0A218USB3_BCL2L1-      -----LTG-------------------------ATVAGV-----------
H0Z8G3_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
A0A218USB3_BCL2L1-      -----LTG-------------------------ATVAGV-----------
U3JSL7_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
A0A218USB3_BCL2L1-      -----LTG-------------------------ATVAGV-----------
A0A218USB3_BCL2L1-      -----LTG-------------------------ATVAGV-----------
Q4U2V6_BCL2L1-01        -----LTG-------------------------ATVAGV-----------
D2ITA2_BCL2L1-02        -----LVG-------------------------AALLTG-----------
A0A3B3E2W4_BCL2L1-      -----LVA-------------------------VALLTG-----------
A0A3B3I2Q5_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3P9I2N4_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3P9MKK4_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3B5B4X7_BCL2L1-      -----LVG-------------------------GALLTG-----------
A0A3B4BFZ8_BCL2L1-      -----LVG-------------------------VGLLAG-----------
A0A3Q3FUB6_BCL2L1-      -----LVG-------------------------MALLMG-----------
A0A3B5MGS2_BCL2L1-      -----LVG-------------------------VALLTG-----------
M4A558_BCL2L1-01        -----LVG-------------------------VALLTG-----------
A0A3P9QFB3_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A087YBW4_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A3B3VWI7_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A3B3XN57_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A3Q2C6K4_BCL2L1-      -----LVG-------------------------AALLGG-----------
A0A3Q2NRP4_BCL2L1-      -----LVG-------------------------AALLTG-----------
A0A0B4KJI5_BCL2L1-      -----LVG-------------------------VALLMG-----------
A0A3Q1JZ46_BCL2L1-      -----LVG-------------------------VVLLTG-----------
A0A3Q1JZ46_BCL2L1-      -----LVG-------------------------VVLLTG-----------
A0A3Q3NFM4_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A3Q3NFM4_BCL2L1-      -----LVG-------------------------VALLTG-----------
A0A3B4V9K8_BCL2L1-      -----LVG-------------------------VAMLAG-----------
A0A3B4XS24_BCL2L1-      -----LVG-------------------------VAMLAG-----------
C1BLI0_BCL2L1-01        -----LVG-------------------------AILLAG-----------
C0HAD8_BCL2L1-01        -----LVG-------------------------VILLSG-----------
A0A3B3ZMX9_BCL2L1-      -----FAG-------------------------MTLVTG-----------
A0A3B5K6B9_BCL2L1-      -----LVG-------------------------MSLAAG-----------
A0A3B5K6B9_BCL2L1-      -----LVG-------------------------MSLAAG-----------
H3CH49_BCL2L1-01        -----FLG-------------------------MSLAAG-----------
A0A3B3TFR4_BCL2L1-      -----PAA-------------------------MALVAG-----------
A0A3P8XYL5_BCL2L1-      -----LAG-------------------------MTLVTG-----------
Q90Z98_BCL2L1-02        -----FAG-------------------------MTLLTG-----------
Q90Z98_BCL2L1-01        -----FAG-------------------------MTLLTG-----------
A0A059PJI5_BCL2L1-      -----LAG-------------------------VTLFTG-----------
A0A3B4DTL9_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q2FR43_BCL2L1-      -----LLG-------------------------MSVATA-----------
B5XAY3_BCL2L1-01        -----LAG-------------------------MTLVTG-----------
W5MG74_BCL2L1-01        -----LAG-------------------------MTLVTG-----------
A0A2U9BY16_BCL2L1-      -----AAGQRGEKQEGVQCHGCNRLTHPPPLSVVCVVAG-----------
A0A3Q3B3X5_BCL2L1-      -----LVG-------------------------MTVVTA-----------
A0A3B3IB64_BCL2L1-      -----LVG-------------------------MTVATG-----------
A0A3P9JYH1_BCL2L1-      -----LVG-------------------------MTVATG-----------
A0A3B3DHA1_BCL2L1-      -----LVG-------------------------MTVATG-----------
A0A3Q0RTF8_BCL2L1-      -----LVG-------------------------MTVVTG-----------
I3IZK7_BCL2L1-01        -----LVG-------------------------MTVVTG-----------
A0A2U9BY16_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A2U9BY16_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A2U9BY16_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A0D6DR75_BCL2L1-      -----LAG-------------------------MTVVTG-----------
A0A3Q3WIW8_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A219P0Y3_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3MX20_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3G2E1_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3G2E1_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3G2E1_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q1GZ93_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q1GZ93_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q1GZ93_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3B4V3T1_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3B4XU17_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3P9MKK4_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3B3I2Q5_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3P9I2N4_BCL2L1-      -----LVT-------------------------VALLTG-----------
A0A3B3QRZ2_BCL2L1-      -----LAG-------------------------MTLITG-----------
A0A3B3ZMX9_BCL2L1-      -----FAG-------------------------MTLVTG-----------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3DUT7_BCL2L1-      -----LAG-------------------------VTLVTG-----------
A0A3Q3DUT7_BCL2L1-      -----LAG-------------------------VTLVTG-----------
A0A3Q3DUT7_BCL2L1-      -----LAG-------------------------VTLVTG-----------
A0A3B1JJ42_BCL2L1-      -----LVG-------------------------MTLFTG-----------
A0A3P8UWG7_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q3IVF5_BCL2L1-      -----LAG-------------------------MTLVTG-----------
A0A3Q1DHJ3_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q1DHJ3_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q1DHJ3_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3P8TL99_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3P8TL99_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q1FR00_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3B4Z3X2_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3B4Z3X2_BCL2L1-      -----LVG-------------------------MTVVTG-----------
C3VIT1_BCL2L1-01        -----LVG-------------------------MTVVTG-----------
A0A3P8P0F1_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q2X557_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3P9D632_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3P9D632_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q4N4B5_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3B4FNX1_BCL2L1-      -----LVG-------------------------MTVVTG-----------
A0A3Q2QPL9_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A3B5PQJ0_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A087X9B7_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A3B3TUS7_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A3B3WI27_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A3P9N9Y4_BCL2L1-      -----LLG-------------------------MSVVTA-----------
A0A3Q3BEB7_BCL2L1-      -----LAG-------------------------AALLAG-----------
A0A3P8VMA1_BCL2L1-      -----LVG-------------------------AGLLAA-----------
A0A345BSW9_BCL2L1-      ---------------------------------LLAFLS-----------
A0A286MU87_BCL2L1-      -----LVG-------------------------VILLSG-----------
A0A3P8XFS0_BCL2L1-      -----LFG------------------------------------------
A0A3P8XFS0_BCL2L1-      -----LFG-------------------------VMLLSG-----------
A0A0F7L1T6_BCL2L1-      -----LGG-------------------------LALLMG-----------
H2U5I3_BCL2L1-01        -----LGG-------------------------LALLMG-----------
H2U5I3_BCL2L1-02        -----LGG-------------------------LALLMG-----------
A0A3Q3J5K3_BCL2L1-      -----LVG-------------------------VVLLTG-----------
A0A3Q1EVP6_BCL2L1-      -----LAG-------------------------GVLLMG-----------
A0A3Q1BQA0_BCL2L1-      -----LVG-------------------------GVLLMG-----------
A0A3P8U812_BCL2L1-      -----LVG-------------------------GVLLMG-----------
E6ZFR0_BCL2L1-01        -----LIG-------------------------VALLMG-----------
G3P7B4_BCL2L1-01        -----LVG-------------------------VALLMG-----------
A0A3Q3X5M5_BCL2L1-      -----LVG-------------------------VALLMG-----------
A0A2U9BIG9_BCL2L1-      -----LVG-------------------------VGMLTG-----------
                                                                          

A0A3Q1FR00_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
R4JQR8_BCL2L1-01        -------------------MALSAFLHRT---------------------
A0A346RRN1_BCL2L1-      -------------------LALGALLQRV---------------------
Q2TAP5_BCL2L1-01        -------------------VFALVCYMRRR--------------------
Q91828_BCL2L1-01        -------------------VFALVCYMRRR--------------------
I7GKS6_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A2K5EBP4_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5Q6R6_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6UWY8_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5M8B1_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5H963_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5VPG2_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5YR37_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2R8Z9D7_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A096NV05_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6QFA2_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A1U7T4L4_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6G3C5_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A3Q1LRT3_BCL2L1-      -------------------FLIKHIFTKQPSNCTLEHLSGRYATLL----
H9GHK7_BCL2L1-01        ------------IYTHHSEVCLNTYID-----------------------
Q07816_BCL2L1-04        -------------------LLLS---------------------------
A0A493TIA6_BCL2L1-      -------------------LPPGLGF------------------------
Q07816_BCL2L1-03        -------------------LLLGSLLSRK---------------------
Q07816_BCL2L1-02        -------------------LLLGSLLSRK---------------------
Q07816_BCL2L1-01        -------------------LLLGSLLSRK---------------------
G1N5N5_BCL2L1-01        -------------------LLLGSLLSRK---------------------
A0A452ILL8_BCL2L1-      -------------------LLLGSLLSRK---------------------
A0A452ILL8_BCL2L1-      -------------------LLLGSLLSRK---------------------
K7F655_BCL2L1-01        -------------------LLLGSLLSRK---------------------
A0A452E1B1_BCL2L1-      -------------------ALLGLLFNT----------------------
W5PSA5_BCL2L1-01        -------------------ALLGLLFNCK---------------------
P53563_BCL2L1-02        IPGVNFGNIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLK
P53563_BCL2L1-03        IPGVNFGNIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLK
A0A287CZ07_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A3Q2H0F6_BCL2L1-      ------------------------EMPLQ---------------------
F6WA14_BCL2L1-01        -------------------VLLGSLFSRK---------------------
G3WKX6_BCL2L1-01        -------------------VLLGSLFSRK---------------------
M3XA94_BCL2L1-01        -------------------CSGDKLFCNQLPQNLS---------------
M3XA94_BCL2L1-02        -------------------LPSQGRSSRRRGRC-----------------
H0X6V2_BCL2L1-01        -------------------CLTIGVMGYS---------------------
G3SPN0_BCL2L1-01        -------------------LTLTQWFTTQ---------------------
Q2PFS6_BCL2L1-01        -------------------VLLGSLFSRK---------------------
O35843_BCL2L1-01        ----------------AEHVCDPSLWEVETEGSEVQGPPQLL--------
M3XA94_BCL2L1-03        -------------------MNMRLLLDAG---------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      -------------------VMLGSLFSRK---------------------
Q64373_BCL2L1-09        -------------------VLLGSLFSRK---------------------
Q64373_BCL2L1-01        -------------------VLLGSLFSRK---------------------
P53563_BCL2L1-01        -------------------VLLGSLFSRK---------------------
O77737_BCL2L1-01        -------------------VLLGSLFSRK---------------------
Q9MYW4_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A3Q2H0F6_BCL2L1-      -------------------VLLGSLFSRK---------------------
L8J061_BCL2L1-01        -------------------VLLGSLFSRK---------------------
Q05KJ0_BCL2L1-02        -------------------VLLGSLFSRK---------------------
Q05KJ0_BCL2L1-01        -------------------VLLGSLFSRK---------------------
E2IV76_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A2K6G3C5_BCL2L1-      -------------------VLLGSLFSRK---------------------
B2Z3Z4_BCL2L1-01        -------------------VLLGSLFSRK---------------------
G3HEA7_BCL2L1-02        -------------------VLLGSLFSRK---------------------
G3HEA7_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A1U7T4L4_BCL2L1-      -------------------VLLGSLFSRK---------------------
M3Z2H9_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A1U7QU73_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A0D9RJZ8_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A286Y5D6_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A250YD48_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A1L5BWY3_BCL2L1-      -------------------VLLGSLFSRK---------------------
I3MUP5_BCL2L1-01        -------------------VLLGSLFSRK---------------------
I3MUP5_BCL2L1-02        -------------------VLLGSLFSRK---------------------
I3MUP5_BCL2L1-03        -------------------VLLGSLFSRK---------------------
G1P9D2_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A2K5EBP4_BCL2L1-      -------------------VLLGSLFSRK---------------------
E2IV75_BCL2L1-01        -------------------VLLGSLFSRK---------------------
F7IT34_BCL2L1-01        -------------------VLLGSLFSRK---------------------
Q76LT7_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A2K5Q6R6_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5Q6R6_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5M8B1_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5H963_BCL2L1-      -------------------VLLGSLFSRK---------------------
Q8SQ42_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A2K5VPG2_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K5YR37_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2R8Z9D7_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A096NV05_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2J8VIH3_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6QFA2_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6QFA2_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A2K6UWY8_BCL2L1-      -------------------VLLGSLFSRK---------------------
E2IV77_BCL2L1-01        -------------------VLLGSLFSRK---------------------
A0A452SDS4_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A384D3U1_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A452FWV3_BCL2L1-      -------------------VLLGSLFSRK---------------------
Q9MZS7_BCL2L1-01        -------------------VLLGSLFSRK---------------------
H3ANS8_BCL2L1-01        -------------------LFLRK--------------------------
A0A452FHY1_BCL2L1-      --------------------GLALQLIVT--VPFITVIHVLHKLVFPS-F
A0A452FHY1_BCL2L1-      -------------------SGLSRKAAVSKDTPWLT---------FPSPH
A0A1S3EPX7_BCL2L1-      -------------------VLLGSLFSRK---------------------
A0A218USB3_BCL2L1-      -------------------LLLSTDSCCSCRTRSDPAWGARGLALAH---
H0Z8G3_BCL2L1-01        -------------------LLLGSLLSRK---------------------
A0A218USB3_BCL2L1-      -------------------LLLSTRISISPLNASVCRWR-----------
U3JSL7_BCL2L1-01        -------------------LLLGSLLSRK---------------------
A0A218USB3_BCL2L1-      -------------------LLLGSLLSRK---------------------
A0A218USB3_BCL2L1-      -------------------LLLGSLLSRK---------------------
Q4U2V6_BCL2L1-01        -------------------LLLGSLLSRK---------------------
D2ITA2_BCL2L1-02        -------------------VLLGALLAKKHV-------------------
A0A3B3E2W4_BCL2L1-      -------------------LLLGLLIAKKR--------------------
A0A3B3I2Q5_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3P9I2N4_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3P9MKK4_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3B5B4X7_BCL2L1-      -------------------VLAGVLIAKKQ--------------------
A0A3B4BFZ8_BCL2L1-      -------------------VLVAMLIAKK---------------------
A0A3Q3FUB6_BCL2L1-      -------------------VVVGVYIAKKH--------------------
A0A3B5MGS2_BCL2L1-      -------------------ALLVVFVAKKR--------------------
M4A558_BCL2L1-01        -------------------ALLVVFVAKKR--------------------
A0A3P9QFB3_BCL2L1-      -------------------ALLVMFIAKKR--------------------
A0A087YBW4_BCL2L1-      -------------------ALLVMFVAKKR--------------------
A0A3B3VWI7_BCL2L1-      -------------------ALLVMFVAKKR--------------------
A0A3B3XN57_BCL2L1-      -------------------ALLVMFVAKKR--------------------
A0A3Q2C6K4_BCL2L1-      -------------------VLLTVLVAKKR--------------------
A0A3Q2NRP4_BCL2L1-      -------------------FLLVVLFAKKR--------------------
A0A0B4KJI5_BCL2L1-      -------------------VVLGVLIAKKQ--------------------
A0A3Q1JZ46_BCL2L1-      -------------------VLLGVLIAKKR--------------------
A0A3Q1JZ46_BCL2L1-      -------------------VLLGVLIAKKR--------------------
A0A3Q3NFM4_BCL2L1-      -------------------VLIGVLIAKKQ--------------------
A0A3Q3NFM4_BCL2L1-      -------------------VLIGVLIAKKQ--------------------
A0A3B4V9K8_BCL2L1-      -------------------VLMGVLIVKKH--------------------
A0A3B4XS24_BCL2L1-      -------------------VLMGVLIVKKH--------------------
C1BLI0_BCL2L1-01        -------------------VLVGSLIAKKHH-------------------
C0HAD8_BCL2L1-01        -------------------VLVGTLIMKKRQ-------------------
A0A3B3ZMX9_BCL2L1-      -------------------VVVGSLLAQRRL-------------------
A0A3B5K6B9_BCL2L1-      -------------------IAIGSFIVRKLL-------------------
A0A3B5K6B9_BCL2L1-      -------------------IAIGSFIVRKLL-------------------
H3CH49_BCL2L1-01        -------------------IALGSFIVMR---------------------
A0A3B3TFR4_BCL2L1-      -------------------ALVGFLIAKKRQ-------------------
A0A3P8XYL5_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
Q90Z98_BCL2L1-02        -------------------VVVGGLIAQKRL-------------------
Q90Z98_BCL2L1-01        -------------------VVVGGLIAQKRL-------------------
A0A059PJI5_BCL2L1-      -------------------VVVGSFIAQKRL-------------------
A0A3B4DTL9_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q2FR43_BCL2L1-      -------------------LIAGSIFAHKRL-------------------
B5XAY3_BCL2L1-01        -------------------VVVGSLFAQKRL-------------------
W5MG74_BCL2L1-01        -------------------LVVGSYIAKKRL-------------------
A0A2U9BY16_BCL2L1-      -------------------SLSLIFSTARGI-------------------
A0A3Q3B3X5_BCL2L1-      -------------------VVAGSLFAQKRL-------------------
A0A3B3IB64_BCL2L1-      -------------------VLVGSFLAQKRL-------------------
A0A3P9JYH1_BCL2L1-      -------------------VLVGSFLAQKRL-------------------
A0A3B3DHA1_BCL2L1-      -------------------VLVGSFIAQKRL-------------------
A0A3Q0RTF8_BCL2L1-      -------------------VVAGALIAQKRL-------------------
I3IZK7_BCL2L1-01        -------------------VVAGALIAQKRL-------------------
A0A2U9BY16_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A2U9BY16_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A2U9BY16_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A0D6DR75_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3Q3WIW8_BCL2L1-      -------------------VVVGSLIVQKRL-------------------
A0A219P0Y3_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3MX20_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3G2E1_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3G2E1_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3G2E1_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1GZ93_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1GZ93_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1GZ93_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B4V3T1_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B4XU17_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3P9MKK4_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3B3I2Q5_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3P9I2N4_BCL2L1-      -------------------LLLGVLITKKR--------------------
A0A3B3QRZ2_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B3ZMX9_BCL2L1-      -------------------VVVGSLLAQRRL-------------------
G3NJY1_BCL2L1-01        ---------------------------RSDI-------------------
A0A2U9BY16_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3DUT7_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3DUT7_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3DUT7_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B1JJ42_BCL2L1-      -------------------IVVGSLIAQKRL-------------------
A0A3P8UWG7_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q3IVF5_BCL2L1-      -------------------VVVGSLIIQKRL-------------------
A0A3Q1DHJ3_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1DHJ3_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1DHJ3_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3P8TL99_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3P8TL99_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3Q1FR00_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B4Z3X2_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
A0A3B4Z3X2_BCL2L1-      -------------------VVVGSLIAQKRL-------------------
C3VIT1_BCL2L1-01        -------------------VVVGSLFAQKRL-------------------
A0A3P8P0F1_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3Q2X557_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3P9D632_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3P9D632_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3Q4N4B5_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3B4FNX1_BCL2L1-      -------------------VVAGALIAQKRL-------------------
A0A3Q2QPL9_BCL2L1-      -------------------FIAGSIFVQKRL-------------------
A0A3B5PQJ0_BCL2L1-      -------------------FIAGSIFAQKRL-------------------
A0A087X9B7_BCL2L1-      -------------------FIAGSIFAQKRL-------------------
A0A3B3TUS7_BCL2L1-      -------------------FIAGSIFAQKRL-------------------
A0A3B3WI27_BCL2L1-      -------------------FIAGSIFAQKRL-------------------
A0A3P9N9Y4_BCL2L1-      -------------------FIAGSIFAQKRL-------------------
A0A3Q3BEB7_BCL2L1-      -------------------LLLGVLVAKKR--------------------
A0A3P8VMA1_BCL2L1-      -------------------VLIGVLITKKH--------------------
A0A345BSW9_BCL2L1-      -------------------YLVPFLQFNHKEPL-----------------
A0A286MU87_BCL2L1-      -------------------VLVGTLIMKKRQ-------------------
A0A3P8XFS0_BCL2L1-      --------------------------MENAQWT-----------------
A0A3P8XFS0_BCL2L1-      -------------------VLVGTLLMKKRQ-------------------
A0A0F7L1T6_BCL2L1-      -------------------VLVGAFIVKKH--------------------
H2U5I3_BCL2L1-01        -------------------VLVGAFIVKKH--------------------
H2U5I3_BCL2L1-02        -------------------VLVGAFIVKKH--------------------
A0A3Q3J5K3_BCL2L1-      -------------------VLVGVLVAKKL--------------------
A0A3Q1EVP6_BCL2L1-      -------------------VLAGVLIAKKQ--------------------
A0A3Q1BQA0_BCL2L1-      -------------------VLAGVLIAKKQ--------------------
A0A3P8U812_BCL2L1-      -------------------VLAGVLIAKKQ--------------------
E6ZFR0_BCL2L1-01        -------------------AVVGVLIAKKH--------------------
G3P7B4_BCL2L1-01        -------------------VLVGMVMVKKR--------------------
A0A3Q3X5M5_BCL2L1-      -------------------VMVGVFIAKKQ--------------------
A0A2U9BIG9_BCL2L1-      -------------------VLIAMFIAKKQ--------------------
                                                                          

A0A3Q1FR00_BCL2L1-      ---------
R4JQR8_BCL2L1-01        ---------
A0A346RRN1_BCL2L1-      ---------
Q2TAP5_BCL2L1-01        ---------
Q91828_BCL2L1-01        ---------
I7GKS6_BCL2L1-01        ---------
A0A2K5EBP4_BCL2L1-      ---------
A0A2K5Q6R6_BCL2L1-      ---------
A0A2K6UWY8_BCL2L1-      ---------
A0A2K5M8B1_BCL2L1-      ---------
A0A2K5H963_BCL2L1-      ---------
A0A2K5VPG2_BCL2L1-      ---------
A0A2K5YR37_BCL2L1-      ---------
A0A2R8Z9D7_BCL2L1-      ---------
A0A096NV05_BCL2L1-      ---------
A0A2K6QFA2_BCL2L1-      ---------
A0A1U7T4L4_BCL2L1-      ---------
A0A2K6G3C5_BCL2L1-      ---------
A0A3Q1LRT3_BCL2L1-      ---------
H9GHK7_BCL2L1-01        ---------
Q07816_BCL2L1-04        ---------
A0A493TIA6_BCL2L1-      ---------
Q07816_BCL2L1-03        ---------
Q07816_BCL2L1-02        ---------
Q07816_BCL2L1-01        ---------
G1N5N5_BCL2L1-01        ---------
A0A452ILL8_BCL2L1-      ---------
A0A452ILL8_BCL2L1-      ---------
K7F655_BCL2L1-01        ---------
A0A452E1B1_BCL2L1-      ---------
W5PSA5_BCL2L1-01        ---------
P53563_BCL2L1-02        T--------
P53563_BCL2L1-03        T--------
A0A287CZ07_BCL2L1-      ---------
A0A3Q2H0F6_BCL2L1-      ---------
F6WA14_BCL2L1-01        ---------
G3WKX6_BCL2L1-01        ---------
M3XA94_BCL2L1-01        ---------
M3XA94_BCL2L1-02        ---------
H0X6V2_BCL2L1-01        ---------
G3SPN0_BCL2L1-01        ---------
Q2PFS6_BCL2L1-01        ---------
O35843_BCL2L1-01        ---------
M3XA94_BCL2L1-03        ---------
G1RER8_BCL2L1-01        ---------
A0A1S2ZQT6_BCL2L1-      ---------
Q64373_BCL2L1-09        ---------
Q64373_BCL2L1-01        ---------
P53563_BCL2L1-01        ---------
O77737_BCL2L1-01        ---------
Q9MYW4_BCL2L1-01        ---------
A0A3Q2H0F6_BCL2L1-      ---------
L8J061_BCL2L1-01        ---------
Q05KJ0_BCL2L1-02        ---------
Q05KJ0_BCL2L1-01        ---------
E2IV76_BCL2L1-01        ---------
A0A2K6G3C5_BCL2L1-      ---------
B2Z3Z4_BCL2L1-01        ---------
G3HEA7_BCL2L1-02        ---------
G3HEA7_BCL2L1-01        ---------
A0A1U7T4L4_BCL2L1-      ---------
M3Z2H9_BCL2L1-01        ---------
A0A1U7QU73_BCL2L1-      ---------
A0A0D9RJZ8_BCL2L1-      ---------
A0A286Y5D6_BCL2L1-      ---------
A0A250YD48_BCL2L1-      ---------
A0A1L5BWY3_BCL2L1-      ---------
I3MUP5_BCL2L1-01        ---------
I3MUP5_BCL2L1-02        ---------
I3MUP5_BCL2L1-03        ---------
G1P9D2_BCL2L1-01        ---------
A0A2K5EBP4_BCL2L1-      ---------
E2IV75_BCL2L1-01        ---------
F7IT34_BCL2L1-01        ---------
Q76LT7_BCL2L1-01        ---------
A0A2K5Q6R6_BCL2L1-      ---------
A0A2K5Q6R6_BCL2L1-      ---------
A0A2K5M8B1_BCL2L1-      ---------
A0A2K5H963_BCL2L1-      ---------
Q8SQ42_BCL2L1-01        ---------
A0A2K5VPG2_BCL2L1-      ---------
A0A2K5YR37_BCL2L1-      ---------
A0A2R8Z9D7_BCL2L1-      ---------
A0A096NV05_BCL2L1-      ---------
A0A2J8VIH3_BCL2L1-      ---------
A0A2K6QFA2_BCL2L1-      ---------
A0A2K6QFA2_BCL2L1-      ---------
A0A2K6UWY8_BCL2L1-      ---------
E2IV77_BCL2L1-01        ---------
A0A452SDS4_BCL2L1-      ---------
A0A384D3U1_BCL2L1-      ---------
A0A452FWV3_BCL2L1-      ---------
Q9MZS7_BCL2L1-01        ---------
H3ANS8_BCL2L1-01        ---------
A0A452FHY1_BCL2L1-      CYSYRDLTI
A0A452FHY1_BCL2L1-      AQAY-----
A0A1S3EPX7_BCL2L1-      ---------
A0A218USB3_BCL2L1-      ---------
H0Z8G3_BCL2L1-01        ---------
A0A218USB3_BCL2L1-      ---------
U3JSL7_BCL2L1-01        ---------
A0A218USB3_BCL2L1-      ---------
A0A218USB3_BCL2L1-      ---------
Q4U2V6_BCL2L1-01        ---------
D2ITA2_BCL2L1-02        ---------
A0A3B3E2W4_BCL2L1-      ---------
A0A3B3I2Q5_BCL2L1-      ---------
A0A3P9I2N4_BCL2L1-      ---------
A0A3P9MKK4_BCL2L1-      ---------
A0A3B5B4X7_BCL2L1-      ---------
A0A3B4BFZ8_BCL2L1-      ---------
A0A3Q3FUB6_BCL2L1-      ---------
A0A3B5MGS2_BCL2L1-      ---------
M4A558_BCL2L1-01        ---------
A0A3P9QFB3_BCL2L1-      ---------
A0A087YBW4_BCL2L1-      ---------
A0A3B3VWI7_BCL2L1-      ---------
A0A3B3XN57_BCL2L1-      ---------
A0A3Q2C6K4_BCL2L1-      ---------
A0A3Q2NRP4_BCL2L1-      ---------
A0A0B4KJI5_BCL2L1-      ---------
A0A3Q1JZ46_BCL2L1-      ---------
A0A3Q1JZ46_BCL2L1-      ---------
A0A3Q3NFM4_BCL2L1-      ---------
A0A3Q3NFM4_BCL2L1-      ---------
A0A3B4V9K8_BCL2L1-      ---------
A0A3B4XS24_BCL2L1-      ---------
C1BLI0_BCL2L1-01        ---------
C0HAD8_BCL2L1-01        ---------
A0A3B3ZMX9_BCL2L1-      ---------
A0A3B5K6B9_BCL2L1-      ---------
A0A3B5K6B9_BCL2L1-      ---------
H3CH49_BCL2L1-01        ---------
A0A3B3TFR4_BCL2L1-      ---------
A0A3P8XYL5_BCL2L1-      ---------
Q90Z98_BCL2L1-02        ---------
Q90Z98_BCL2L1-01        ---------
A0A059PJI5_BCL2L1-      ---------
A0A3B4DTL9_BCL2L1-      ---------
A0A3Q2FR43_BCL2L1-      ---------
B5XAY3_BCL2L1-01        ---------
W5MG74_BCL2L1-01        ---------
A0A2U9BY16_BCL2L1-      ---------
A0A3Q3B3X5_BCL2L1-      ---------
A0A3B3IB64_BCL2L1-      ---------
A0A3P9JYH1_BCL2L1-      ---------
A0A3B3DHA1_BCL2L1-      ---------
A0A3Q0RTF8_BCL2L1-      ---------
I3IZK7_BCL2L1-01        ---------
A0A2U9BY16_BCL2L1-      ---------
A0A2U9BY16_BCL2L1-      ---------
A0A2U9BY16_BCL2L1-      ---------
A0A0D6DR75_BCL2L1-      ---------
A0A3Q3WIW8_BCL2L1-      ---------
A0A219P0Y3_BCL2L1-      ---------
A0A3Q3MX20_BCL2L1-      ---------
A0A3Q3G2E1_BCL2L1-      ---------
A0A3Q3G2E1_BCL2L1-      ---------
A0A3Q3G2E1_BCL2L1-      ---------
A0A3Q1GZ93_BCL2L1-      ---------
A0A3Q1GZ93_BCL2L1-      ---------
A0A3Q1GZ93_BCL2L1-      ---------
A0A3B4V3T1_BCL2L1-      ---------
A0A3B4XU17_BCL2L1-      ---------
A0A3P9MKK4_BCL2L1-      ---------
A0A3B3I2Q5_BCL2L1-      ---------
A0A3P9I2N4_BCL2L1-      ---------
A0A3B3QRZ2_BCL2L1-      ---------
A0A3B3ZMX9_BCL2L1-      ---------
G3NJY1_BCL2L1-01        ---------
A0A2U9BY16_BCL2L1-      ---------
A0A3Q3DUT7_BCL2L1-      ---------
A0A3Q3DUT7_BCL2L1-      ---------
A0A3Q3DUT7_BCL2L1-      ---------
A0A3B1JJ42_BCL2L1-      ---------
A0A3P8UWG7_BCL2L1-      ---------
A0A3Q3IVF5_BCL2L1-      ---------
A0A3Q1DHJ3_BCL2L1-      ---------
A0A3Q1DHJ3_BCL2L1-      ---------
A0A3Q1DHJ3_BCL2L1-      ---------
A0A3P8TL99_BCL2L1-      ---------
A0A3P8TL99_BCL2L1-      ---------
A0A3Q1FR00_BCL2L1-      ---------
A0A3B4Z3X2_BCL2L1-      ---------
A0A3B4Z3X2_BCL2L1-      ---------
C3VIT1_BCL2L1-01        ---------
A0A3P8P0F1_BCL2L1-      ---------
A0A3Q2X557_BCL2L1-      ---------
A0A3P9D632_BCL2L1-      ---------
A0A3P9D632_BCL2L1-      ---------
A0A3Q4N4B5_BCL2L1-      ---------
A0A3B4FNX1_BCL2L1-      ---------
A0A3Q2QPL9_BCL2L1-      ---------
A0A3B5PQJ0_BCL2L1-      ---------
A0A087X9B7_BCL2L1-      ---------
A0A3B3TUS7_BCL2L1-      ---------
A0A3B3WI27_BCL2L1-      ---------
A0A3P9N9Y4_BCL2L1-      ---------
A0A3Q3BEB7_BCL2L1-      ---------
A0A3P8VMA1_BCL2L1-      ---------
A0A345BSW9_BCL2L1-      ---------
A0A286MU87_BCL2L1-      ---------
A0A3P8XFS0_BCL2L1-      ---------
A0A3P8XFS0_BCL2L1-      ---------
A0A0F7L1T6_BCL2L1-      ---------
H2U5I3_BCL2L1-01        ---------
H2U5I3_BCL2L1-02        ---------
A0A3Q3J5K3_BCL2L1-      ---------
A0A3Q1EVP6_BCL2L1-      ---------
A0A3Q1BQA0_BCL2L1-      ---------
A0A3P8U812_BCL2L1-      ---------
E6ZFR0_BCL2L1-01        ---------
G3P7B4_BCL2L1-01        ---------
A0A3Q3X5M5_BCL2L1-      ---------
A0A2U9BIG9_BCL2L1-      ---------
                                 

© 1998-2020Legal notice