Dataset for protein Bcl-xL of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

212 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1FR00_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLVFTPERPVDIS
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      GPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFY
R4JQR8_BCL2L1-01        -------------------------------------MNQFSSRYLVADF
A0A346RRN1_BCL2L1-      -------------------------------------MNQYSSRYLVVDF
Q2TAP5_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
Q91828_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------MSQSNRELVVDF
H9GHK7_BCL2L1-01        --------------------------------------MSSSNRALVVDF
Q07816_BCL2L1-04        --------------------------------------MSSSNRELVIDF
A0A493TIA6_BCL2L1-      --------------------------------------MSSGNRELVIDF
Q07816_BCL2L1-02        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-03        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-01        --------------------------------------MSSSNRELVIDF
G1N5N5_BCL2L1-01        --------------------------------------MSSSNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
K7F655_BCL2L1-01        --------------------------------------MSNTNRELVIDF
A0A452E1B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
W5PSA5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-03        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-02        --------------------------------------MSQSNRELVVDF
A0A287CZ07_BCL2L1-      --------------------------------------MSQSNRELVVDF
F6WA14_BCL2L1-01        --------------------------------------MSHSNRELVIDF
G3WKX6_BCL2L1-01        --------------------------------------MSHSNRELVVDF
M3XA94_BCL2L1-01        --------------------------------------MSQSNRELVVDF
M3XA94_BCL2L1-02        --------------------------------------MSQSNRELVVDF
A0A3Q2H0F6_BCL2L1-      --------------------------------------MSQSNRELVVDF
H0X6V2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3SPN0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------MSQSNRELVVDF
M3XA94_BCL2L1-03        --------------------------------------MSQSNRELVVDF
G1RER8_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A1S2ZQT6_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-09        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-01        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-01        --------------------------------------MSQSNRELVVDF
O77737_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q9MYW4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A3Q2H0F6_BCL2L1-      --------------------------------------MSQSNRELVVDF
L8J061_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-02        --------------------------------------MSQSNRELVVDF
E2IV76_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K6G3C5_BCL2L1-      --------------------------------------MSQSNRELVVDF
B2Z3Z4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3HEA7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3HEA7_BCL2L1-02        --------------------------------------MSQSNRELVVDF
A0A1U7T4L4_BCL2L1-      --------------------------------------MSQSNRELVVDF
M3Z2H9_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A1U7QU73_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A0D9RJZ8_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A286Y5D6_BCL2L1-      --------------------------------------MSQSNWELVVDF
A0A250YD48_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A1L5BWY3_BCL2L1-      --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-02        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-03        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G1P9D2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5EBP4_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV75_BCL2L1-01        --------------------------------------MSQSNRELVVDF
F7IT34_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q76LT7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5Q6R6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5Q6R6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5M8B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5H963_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q8SQ42_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5VPG2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5YR37_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2R8Z9D7_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A096NV05_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2J8VIH3_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6UWY8_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV77_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A452SDS4_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A384D3U1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FWV3_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q9MZS7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
D2ITA2_BCL2L1-02        --------------------------------MSIDTSMSISNRELVFFF
A0A3P9MKK4_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3B3I2Q5_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3P9I2N4_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3B3QRZ2_BCL2L1-      --------------------------------------MSYSNRELVMDF
A0A3B3ZMX9_BCL2L1-      ---------------------------------------MSLNRELVEFY
G3NJY1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A2U9BY16_BCL2L1-      -----------------------------DARQRFCGEHHSRPEWIRQLF
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B1JJ42_BCL2L1-      -------------------------------------VMSYYNRELVVYF
A0A3P8UWG7_BCL2L1-      ------------------------------------TLTFNINRKLVVDY
A0A3Q3IVF5_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1FR00_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
C3VIT1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A3P8P0F1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2X557_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q4N4B5_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B4FNX1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2QPL9_BCL2L1-      ---------------------------------------MSQNRELVLSY
A0A3B5PQJ0_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A087X9B7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3TUS7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3WI27_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3P9N9Y4_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3Q3BEB7_BCL2L1-      --------------------------------------MSHSNRDLVQFY
A0A3P8VMA1_BCL2L1-      --------------------------------------MSCSNRELVKFF
A0A345BSW9_BCL2L1-      --------------------------------------MSYYNRELVVFF
A0A286MU87_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A0F7L1T6_BCL2L1-      --------------------------------------MSYNNRELVEHF
H2U5I3_BCL2L1-01        --------------------------------------MSYNNRELVEHF
A0A3Q3J5K3_BCL2L1-      --------------------------------------MSYSHRELVEFY
A0A3Q1EVP6_BCL2L1-      --------------------------------------MSCSNRELVEFF
A0A3Q1BQA0_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3P8U812_BCL2L1-      --------------------------------------MSYSNRELVEFF
E6ZFR0_BCL2L1-01        --------------------------------------MSYSNRELVEFF
G3P7B4_BCL2L1-01        --------------------------------------MANINRELVEFF
A0A3Q3X5M5_BCL2L1-      --------------------------------------MSHSNRELVEFF
A0A2U9BIG9_BCL2L1-      --------------------------------------MSDSNRELVEFF
A0A3B3E2W4_BCL2L1-      --------------------------------------MSHCNRELVQFY
A0A3B3I2Q5_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3P9I2N4_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3P9MKK4_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3B5B4X7_BCL2L1-      -----------------------------------MEIMSYSNRELVEFF
A0A3B4BFZ8_BCL2L1-      --------------------------------------MSPSNRELVEFF
A0A3Q3FUB6_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B5MGS2_BCL2L1-      --------------------------------------MAYSNRELVEFY
M4A558_BCL2L1-01        --------------------------------------MAYSNRELVEFY
A0A3P9QFB3_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A087YBW4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3VWI7_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3XN57_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2C6K4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2NRP4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A0B4KJI5_BCL2L1-      --------------------------------------MSYSNRELVESF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4V9K8_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4XS24_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
C1BLI0_BCL2L1-01        --------------------------------------MSYSNRELVVFF
C0HAD8_BCL2L1-01        --------------------------------------MSYSNRELVVFF
A0A3B3ZMX9_BCL2L1-      ---------------------------------------MSLNRELVEFY
A0A3B3TFR4_BCL2L1-      --------------------------------------MSYSNRELVEYF
H3CH49_BCL2L1-01        ------------------------RSHPGAKSKGASTQRMSLNRELVIFY
A0A3Q2FR43_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P8XYL5_BCL2L1-      --------------------------------------MTYNNKELVAYY
Q90Z98_BCL2L1-02        --------------------------------------MSYYNRELVVFF
Q90Z98_BCL2L1-01        --------------------------------------MSYYNRELVVFF
A0A059PJI5_BCL2L1-      --------------------------------------MSYYNRELVVYF
A0A3B4DTL9_BCL2L1-      --------------------------------------MSYYNRELVVYF
B5XAY3_BCL2L1-01        -------------------------------------MMTYNNRELVVYY
W5MG74_BCL2L1-01        -------------------------------------KMSYSNRDLVVYY
A0A3Q3B3X5_BCL2L1-      ---------------------------------------MSQNKELVLFY
A0A3B3IB64_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3P9JYH1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3B3DHA1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3Q0RTF8_BCL2L1-      ---------------------------------------MSQNRELVLFY
I3IZK7_BCL2L1-01        ---------------------------------------MSQNRELVLFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A0D6DR75_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3Q3WIW8_BCL2L1-      ---------------------------------------MSVNRELVAYY
A0A219P0Y3_BCL2L1-      ---------------------------------------MCQNRELVVCY
A0A3Q3MX20_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4V3T1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4XU17_BCL2L1-      ---------------------------------------MSQNRELVVFY
H3ANS8_BCL2L1-01        --------------------------------------KMSFNRLLVVDH
A0A452FHY1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FHY1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A1S3EPX7_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
U3JSL7_BCL2L1-01        --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
A0A218USB3_BCL2L1-      --------------------------------------MYSSNRELVIDF
H0Z8G3_BCL2L1-01        --------------------------------------MYSSNRELVIDF
Q4U2V6_BCL2L1-01        --------------------------------------MSSSNRELVIDF
                                                                          

A0A3Q1FR00_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPN----
R4JQR8_BCL2L1-01        IND------------------------RLRKHGMRWDNCPTLDLP-----
A0A346RRN1_BCL2L1-      VND------------------------RLRKNGLQWENCPSLEVP-----
Q2TAP5_BCL2L1-01        VSK------------------------KLSQNEACRKFSNNPQPNAISNG
Q91828_BCL2L1-01        VSK------------------------KLSQNEACRKFSNNPNPMPYLME
I7GKS6_BCL2L1-01        ---------------------------MWKRTG-----------------
A0A2K5EBP4_BCL2L1-      ---------------------------MWKRTG-----------------
A0A2K5Q6R6_BCL2L1-      ---------------------------MWKRTG-----------------
A0A2K6UWY8_BCL2L1-      ---------------------------MWKRTG-----------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      LSY------------------------KLSQKGYSWSQFS----------
H9GHK7_BCL2L1-01        LSY------------------------KLSQRGHSWHEIE-----MES--
Q07816_BCL2L1-04        VSY------------------------KLSQRGHCWSELEEEDENRTD--
A0A493TIA6_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRTE--
Q07816_BCL2L1-02        VSY------------------------KLSQRGHCWSELEEEDENRTD--
Q07816_BCL2L1-03        VSY------------------------KLSQRGHCWSELEEEDENRTD--
Q07816_BCL2L1-01        VSY------------------------KLSQRGHCWSELEEEDENRTD--
G1N5N5_BCL2L1-01        VSY------------------------KLSQKGHCWSELEEEDENRTD--
A0A452ILL8_BCL2L1-      LSY------------------------KLSQRGYSWSRFEGEDEIRTD--
A0A452ILL8_BCL2L1-      LSY------------------------KLSQRGYSWSRFEGEDEIRTD--
K7F655_BCL2L1-01        LSY------------------------KLSQRGHSWSWFEGEDEIRTE--
A0A452E1B1_BCL2L1-      LSY------------------------KFFQKGYSWSQFSDMEENRTE--
W5PSA5_BCL2L1-01        LSY------------------------KFFQKGYSWSQFSDMEENRTE--
P53563_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
P53563_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A287CZ07_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
F6WA14_BCL2L1-01        LSY------------------------KLSQKGYNWSQFED--ENRTE--
G3WKX6_BCL2L1-01        LSY------------------------KLSQKGYNWSQFED--ENRTE--
M3XA94_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
M3XA94_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A3Q2H0F6_BCL2L1-      LSY------------------------KLSQKGYNWSQFSDVEENRTE--
H0X6V2_BCL2L1-01        ISY------------------------KLSQKGYSWSQFSDVEENRTE--
G3SPN0_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTG--
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
M3XA94_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
G1RER8_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A1S2ZQT6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q64373_BCL2L1-09        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q64373_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
P53563_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
O77737_BCL2L1-01        LSY------------------------KLSQKGYSWSQFTDVEENRTE--
Q9MYW4_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A3Q2H0F6_BCL2L1-      LSY------------------------KLSQKGYNWSQFSDVEENRTE--
L8J061_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q05KJ0_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q05KJ0_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
E2IV76_BCL2L1-01        LSY------------------------KLSQKGYSWSQFIDAEENRTE--
A0A2K6G3C5_BCL2L1-      LSY------------------------KLSQKGYSWSQFIDAEENRTE--
B2Z3Z4_BCL2L1-01        LSY------------------------KFSQKGYSWSQFSDVEENRTE--
G3HEA7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
G3HEA7_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A1U7T4L4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
M3Z2H9_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDAEENRTE--
A0A1U7QU73_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A0D9RJZ8_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A286Y5D6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A250YD48_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A1L5BWY3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
I3MUP5_BCL2L1-02        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
I3MUP5_BCL2L1-03        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
I3MUP5_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
G1P9D2_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5EBP4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
E2IV75_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
F7IT34_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q76LT7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5Q6R6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5Q6R6_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5M8B1_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5H963_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q8SQ42_BCL2L1-01        LSY------------------------KLSQKGYSWSRFSDVEENRTE--
A0A2K5VPG2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K5YR37_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2R8Z9D7_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A096NV05_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2J8VIH3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K6QFA2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K6QFA2_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A2K6UWY8_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
E2IV77_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A452SDS4_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A384D3U1_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
A0A452FWV3_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEENRTE--
Q9MZS7_BCL2L1-01        LSY------------------------KLSQKGYSWSQFSDVEENRTE--
D2ITA2_BCL2L1-02        LSH------------------------KLSQRNYRPIPFQPEGAGE----
A0A3P9MKK4_BCL2L1-      LTY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3B3I2Q5_BCL2L1-      LTY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3P9I2N4_BCL2L1-      LTY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3B3QRZ2_BCL2L1-      ITY------------------------KLSQRNYN-GHFGLPEDRG----
A0A3B3ZMX9_BCL2L1-      IQY------------------------KLSQRDCPLQHLGLGDRST----
G3NJY1_BCL2L1-01        INY------------------------KLSQRNLPLNHIGLSEPPN----
A0A2U9BY16_BCL2L1-      CRFGFHPQSLLWISADHGCLNRGKQGDSLAQRAFTLT-------------
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIGLRQALN----
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIGLRQALN----
A0A3Q3DUT7_BCL2L1-      IRY------------------------KLSQKNYPLNHIGLRQALN----
A0A3B1JJ42_BCL2L1-      IKY------------------------KLSQRNYPTNHIGLMEETN----
A0A3P8UWG7_BCL2L1-      IQY------------------------KLSQRNFPVHHLGLGDSPN----
A0A3Q3IVF5_BCL2L1-      ITY------------------------KLSQKNYPLSHLGLNESPN----
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPS----
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPS----
A0A3Q1DHJ3_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPS----
A0A3P8TL99_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPS----
A0A3P8TL99_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPS----
A0A3Q1FR00_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPN----
A0A3B4Z3X2_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPN----
A0A3B4Z3X2_BCL2L1-      IKY------------------------KLSQRNYPLNHMVLNEAPN----
C3VIT1_BCL2L1-01        IKY------------------------KLSQRNYPLNHIVLNEPPN----
A0A3P8P0F1_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3Q2X557_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3P9D632_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3P9D632_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3Q4N4B5_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3B4FNX1_BCL2L1-      IRY------------------------KLSQRNYPLNHIVLNEPSN----
A0A3Q2QPL9_BCL2L1-      VKF------------------------KLSQRNYPVNHIMLNEPPS----
A0A3B5PQJ0_BCL2L1-      IKF------------------------KLSQRNYPIQHILPNEPPD----
A0A087X9B7_BCL2L1-      IKF------------------------KLSQRNYPIQHILPNEPPDSTAA
A0A3B3TUS7_BCL2L1-      IKF------------------------KLSQRNYPIQHILPNEPPDSTAA
A0A3B3WI27_BCL2L1-      IKF------------------------KLSQRNYPIQHILPNEPPDSTAA
A0A3P9N9Y4_BCL2L1-      IKF------------------------KLSQRNYPIQHILPNEPPDSTAA
A0A3Q3BEB7_BCL2L1-      ISY------------------------KLSQRNCSKSLLMPEVAGE----
A0A3P8VMA1_BCL2L1-      LGY------------------------KLSQRNYPESLLMLRIGGE----
A0A345BSW9_BCL2L1-      IKY------------------------KLSQRNYPCNHIGLTEDTN----
A0A286MU87_BCL2L1-      ISY------------------------RLSQRNYSCCQLGLEGASG----
A0A3P8XFS0_BCL2L1-      INY------------------------KLSQRNYSCCELELEGASG----
A0A3P8XFS0_BCL2L1-      INY------------------------KLSQRNYSCCELELEGASG----
A0A0F7L1T6_BCL2L1-      LRY------------------------KLSQRNYPSSLLRPEDTDG----
H2U5I3_BCL2L1-01        LRY------------------------KLSQRNYPTSLLRPEDTDG----
A0A3Q3J5K3_BCL2L1-      ISY------------------------KLSQRNYSTSLLRPENAGG----
A0A3Q1EVP6_BCL2L1-      ISY------------------------KLSQRNYPMSLLRPEDAGG----
A0A3Q1BQA0_BCL2L1-      VSD------------------------KLSQRNYPTSLLRPEDAGG----
A0A3P8U812_BCL2L1-      VSY------------------------KLSQRNYPTSLLRPEDAEG----
E6ZFR0_BCL2L1-01        ISY------------------------KLSQRNHPTSLLRPENAGE----
G3P7B4_BCL2L1-01        LSY------------------------KLSQKNHPTSLLRPEDAGG----
A0A3Q3X5M5_BCL2L1-      ISY------------------------KLTQKNYPTSLLRPEDTGG----
A0A2U9BIG9_BCL2L1-      IGY------------------------KLSQRNYPTSLLRPEDAGG----
A0A3B3E2W4_BCL2L1-      LGY------------------------KMSSRDYPVSLLKPTDDGG----
A0A3B3I2Q5_BCL2L1-      LAY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3P9I2N4_BCL2L1-      LAY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3P9MKK4_BCL2L1-      LAY------------------------KMSCRDYPVSLLKPTDDGG----
A0A3B5B4X7_BCL2L1-      ISY------------------------KLSQRNYPTSLLRPEDAAG----
A0A3B4BFZ8_BCL2L1-      ISY------------------------KLSQKNYPSSLLMSDPARV----
A0A3Q3FUB6_BCL2L1-      ISY------------------------KLSQRNYPTYVLRSEDAGE----
A0A3B5MGS2_BCL2L1-      ISY------------------------KLSQRNYSSSLLRSEVAGG----
M4A558_BCL2L1-01        ISY------------------------KLSQRNYSSSLLRSEVAGG----
A0A3P9QFB3_BCL2L1-      ISY------------------------KLSQRNYSSSLLRSEADGA----
A0A087YBW4_BCL2L1-      ISY------------------------KLSQRNYSSSLLRSEADGA----
A0A3B3VWI7_BCL2L1-      ISY------------------------KLSQRNYSSSLLRSEADGA----
A0A3B3XN57_BCL2L1-      ISY------------------------KLSQRNYSSSLLRSEADGA----
A0A3Q2C6K4_BCL2L1-      ISY------------------------KLSQTNCPNSLLRSEVTGG----
A0A3Q2NRP4_BCL2L1-      ISY------------------------KLSQTNCPNSLLRSEVAGD----
A0A0B4KJI5_BCL2L1-      LSY------------------------KLSQRNYPTALLRPDDAGG----
A0A3Q1JZ46_BCL2L1-      IMY------------------------KLSQRNHPASLLRPDDTGG----
A0A3Q1JZ46_BCL2L1-      IMY------------------------KLSQRNHPASLLRPDDTGG----
A0A3Q3NFM4_BCL2L1-      ISY------------------------KLSQKNYPTSLLRPEDAGG----
A0A3Q3NFM4_BCL2L1-      ISY------------------------KLSQKNYPTSLLRPEDAGG----
A0A3B4V9K8_BCL2L1-      ISY------------------------KLSQSNCPTSLLRPEDAGG----
A0A3B4XS24_BCL2L1-      ISY------------------------KLSQSNCPTSLLRPEDAGG----
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMGLNEPPN----
C1BLI0_BCL2L1-01        ISY------------------------KLSQRNYPISQLGLEDASE----
C0HAD8_BCL2L1-01        ISY------------------------RLSQRNYSCCQLGLEGASG----
A0A3B3ZMX9_BCL2L1-      IQY------------------------KLSQRDCPL---------G----
A0A3B3TFR4_BCL2L1-      VSY------------------------KLAQKNYSIAHIIQDEADE----
H3CH49_BCL2L1-01        IKY------------------------KLSQRNYPLSHI--VEPSS----
A0A3Q2FR43_BCL2L1-      IKF------------------------KLSQRNYPVNHIMLNEPPN----
A0A3P8XYL5_BCL2L1-      ITY------------------------KLSQRNYPINHTGLTGAFD----
Q90Z98_BCL2L1-02        IKY------------------------KLSQRNYPCNHIGLTEDTN----
Q90Z98_BCL2L1-01        IKY------------------------KLSQRNYPCNHIGLTEDTN----
A0A059PJI5_BCL2L1-      IKY------------------------KLSQKNYPCDHIGLTEEVN----
A0A3B4DTL9_BCL2L1-      IKY------------------------KLSQRNYPYNHIGLMEDTN----
B5XAY3_BCL2L1-01        ITY------------------------KLSQRDYPFNHMELTEAQN----
W5MG74_BCL2L1-01        INY------------------------KLSQKNYSWDQFSLE---G----
A0A3Q3B3X5_BCL2L1-      IMY------------------------KLSQRNYPVNHIILSDPPN----
A0A3B3IB64_BCL2L1-      VKY------------------------KLSQRNYPLNHIVLNESPN----
A0A3P9JYH1_BCL2L1-      VKY------------------------KLSQRNYPLNHIVLNESPN----
A0A3B3DHA1_BCL2L1-      VKY------------------------KLSQRNYPLNHIVLNESPN----
A0A3Q0RTF8_BCL2L1-      ITY------------------------KLSQRNYPLNHIVLNEPSN----
I3IZK7_BCL2L1-01        IRY------------------------KLSQRNYPLNHIVLNEPLN----
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMGLNEPPN----
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMGLNEPPN----
A0A2U9BY16_BCL2L1-      IQY------------------------KLSQRKYPLNHMGLNEPPN----
A0A0D6DR75_BCL2L1-      ITY------------------------KLSEKNYPLNHLGLSEPPN----
A0A3Q3WIW8_BCL2L1-      INY------------------------KLSHRGCPLNHMGLIEPPN----
A0A219P0Y3_BCL2L1-      IKY------------------------KLTQRNYPLNHMGLIEPPN----
A0A3Q3MX20_BCL2L1-      IKY------------------------KLSQRNYPLIYIELNEQQN----
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHMELLEPPN----
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHMELLEPPN----
A0A3Q3G2E1_BCL2L1-      ITY------------------------KFSQRNYPLNHMELLEPPN----
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLGLNETPN----
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLGLNETPN----
A0A3Q1GZ93_BCL2L1-      ITY------------------------KLSQRNYPLNHLGLNETPN----
A0A3B4V3T1_BCL2L1-      IKH------------------------KLSQRNYPLTHMELNESPN----
A0A3B4XU17_BCL2L1-      IKY------------------------KLSQRNYPLTHMELNESPN----
H3ANS8_BCL2L1-01        ISQ------------------------KLMQRGYQWREVGEQDHGGGG--
A0A452FHY1_BCL2L1-      LSY------------------------KLSQKGFSW--------------
A0A452FHY1_BCL2L1-      LSY------------------------KLSQKGFSW--------------
A0A1S3EPX7_BCL2L1-      LSY------------------------KLSQKGYSWSQFSDVEESRTE--
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRT---
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRT---
U3JSL7_BCL2L1-01        VSY------------------------KLSQKGYSWSQLEEEDENRT---
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRT---
A0A218USB3_BCL2L1-      VSY------------------------KLSQKGYSWSQLEEEDENRT---
H0Z8G3_BCL2L1-01        VSY------------------------KLSQKGYSWSQLEEEDENRT---
Q4U2V6_BCL2L1-01        VSY------------------------KLSQKGYSWSQLEEEDENRT---
                                                                          

A0A3Q1FR00_BCL2L1-      RTDGGEARLGEDQRTETHANGT-------FNGTSPGTPPPSPRRLASTAT
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q2TAP5_BCL2L1-01        TSTSERPGEGATQGIV----------------------------------
Q91828_BCL2L1-01        PSTSERPGEGATQGIV----------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ------VRYGNPQWISGNPSWH-LADSPTVNGATGHSRSL-DARKMIP--
H9GHK7_BCL2L1-01        GEEAMEPANETGNTLNGSPSWH-PSPSHVINGASEHPELLEEEEEENP--
Q07816_BCL2L1-04        ----TAAEAEMDSVLNGSPSWH-PPAGHVVNGATVHRSSL-EVHEIVR--
A0A493TIA6_BCL2L1-      LAS----EA--AAVLNGSPSWH-PPAGQVVNGAAVHRSSL-EVHELVQ--
Q07816_BCL2L1-02        TAA----EAEMDSVLNGSPSWH-PPAGHVVNGATVHRSSL-EVHEIVR--
Q07816_BCL2L1-03        TAA----EAEMDSVLNGSPSWH-PPAGHVVNGATVHRSSL-EVHEIVR--
Q07816_BCL2L1-01        TAA----EAEMDSVLNGSPSWH-PPAGHVVNGATVHRSSL-EVHEIVR--
G1N5N5_BCL2L1-01        TAA----EAEMDSVLNGSPSWH-PPAGHVVNGAAVHRSSL-EVHEIVR--
A0A452ILL8_BCL2L1-      SAE----EAEMASVPNGSPSWH-PGASHIVNGAAGHSNSL-EAHERVP--
A0A452ILL8_BCL2L1-      SAE----EAEMASVPNGSPSWH-PGASHIVNGAAGHSNSL-EAHERVP--
K7F655_BCL2L1-01        AAE----EAEMASVPNGSPSWH-PGASHVVNGAAGHSNSL-EAHERVP--
A0A452E1B1_BCL2L1-      TLEGTESDMETPSAISGNPSWH-LADSSVVNGATGHSRSL-DAGKMIP--
W5PSA5_BCL2L1-01        TLEGTESDMETPSAISGNPSWH-LADSPVVNGATGHSRSL-DTGKMIP--
P53563_BCL2L1-03        APEETEPERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
P53563_BCL2L1-02        APEETEPERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A287CZ07_BCL2L1-      APEGTESEVETPSAINGNPSWH-LADSPAINGATGHSSSL-DAREVIP--
F6WA14_BCL2L1-01        VLEGA----EIPSTVNGSPSWH-PADSRAVSGATGHSSSL-DAHETIP--
G3WKX6_BCL2L1-01        ASEGT----EIPSTVNGSPSWH-PADSRAVSGATGHSSSL-DAHETIP--
M3XA94_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
M3XA94_BCL2L1-02        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A3Q2H0F6_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPTGNGATGHSSSL-DAREVIP--
H0X6V2_BCL2L1-01        APEGNESELETPSAINGNPSWH-LADSPTVNGATGHSSSL-DAREVIP--
G3SPN0_BCL2L1-01        ASEGTESEMEIPSAINGNPSRH-LADSPAVNGATGHSSSL-DAREVIP--
Q2PFS6_BCL2L1-01        --------METPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
O35843_BCL2L1-01        APEETEAERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
M3XA94_BCL2L1-03        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
G1RER8_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A1S2ZQT6_BCL2L1-      ASEGTESEMETPSAINGNPSWH-LADSPALNGATGHSSSL-DAREVIP--
Q64373_BCL2L1-09        APEETEAERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
Q64373_BCL2L1-01        APEETEAERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
P53563_BCL2L1-01        APEETEPERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
O77737_BCL2L1-01        APEGTESEAETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
Q9MYW4_BCL2L1-01        APEGTGPEMETPSAINGNPAWH-PADSPAVNGATGHSSSL-DAREVIP--
A0A3Q2H0F6_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPTGNGATGHSSSL-DAREVIP--
L8J061_BCL2L1-01        APEGTESDMETPSAINGNASWH-LADSPAVNGATGHSRSS-DAREVIP--
Q05KJ0_BCL2L1-01        APEGTESDMETPSAINGNASWH-LADSPAVNGATGHSRSS-DAREVIP--
Q05KJ0_BCL2L1-02        APEGTESDMETPSAINGNASWH-LADSPAVNGATGHSRSS-DAREVIP--
E2IV76_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPPANGATGHSSSL-DAREVIP--
A0A2K6G3C5_BCL2L1-      APEATESEMETPSAINGNPSWH-LADSPPANGATGHSSSL-DAREVIP--
B2Z3Z4_BCL2L1-01        APEGTESERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
G3HEA7_BCL2L1-01        APEGTESERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
G3HEA7_BCL2L1-02        APEGTESERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A1U7T4L4_BCL2L1-      ASEGTESEMETPSAVNGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
M3Z2H9_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A1U7QU73_BCL2L1-      APEGAESERETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A0D9RJZ8_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A286Y5D6_BCL2L1-      GPEGTESEMETPSAINGNPSWH-LTDSPTVNGATGHSSSL-DAREVIP--
A0A250YD48_BCL2L1-      APEGIESEVETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A1L5BWY3_BCL2L1-      APEGIESEVETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
I3MUP5_BCL2L1-02        APEGTESEVETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
I3MUP5_BCL2L1-03        APEGTESEVETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
I3MUP5_BCL2L1-01        APEGTESEVETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
G1P9D2_BCL2L1-01        APEGTESEVETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2K5EBP4_BCL2L1-      APEGTDSEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
E2IV75_BCL2L1-01        APEGTDSEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
F7IT34_BCL2L1-01        APEGTDSEMETPSAINGNPSWH-LADSPVVNGATGHSSSL-DAREVIP--
Q76LT7_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A2K5Q6R6_BCL2L1-      APEGTDSEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A2K5Q6R6_BCL2L1-      APEGTDSEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A2K5M8B1_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2K5H963_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
Q8SQ42_BCL2L1-01        APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A2K5VPG2_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2K5YR37_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2R8Z9D7_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A096NV05_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2J8VIH3_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A2K6QFA2_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2K6QFA2_BCL2L1-      APEGTESEMETPSAINGNPSWH-LVDSPAVNGATGHSSSL-DAREVIP--
A0A2K6UWY8_BCL2L1-      APEGTDSEMETPSAINGNPAWH-LADSPAVNGATGHSSSL-DAREVIP--
E2IV77_BCL2L1-01        APEGTDSEMETPSAINGNPAWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A452SDS4_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A384D3U1_BCL2L1-      APEGTESEMETPSAINGNPSWH-LADSPAVNGATGHSSSL-DAREVIP--
A0A452FWV3_BCL2L1-      APEGTESDMETPSAINGNPSWH-LADSPAVNGATGHSRSL-DAREVIP--
Q9MZS7_BCL2L1-01        APEGTESDMETPSAINGNPSWH-LADSPAVNGATGHSRSL-DAREVIP--
D2ITA2_BCL2L1-02        GTDE------------DKSNRI-GNNGLRLNDGNGNG---QLAPSPTPQG
A0A3P9MKK4_BCL2L1-      ETEE------DHSAARNGRPVS-SEDCQLRRSCPCCA---S---------
A0A3B3I2Q5_BCL2L1-      ETEE------DHSDARNRRLVS-SEDGRLRRSCPCCA---S---------
A0A3P9I2N4_BCL2L1-      ETEE------DHSAARNGRQVS-SEDGQLRRSCPCCA---S---------
A0A3B3QRZ2_BCL2L1-      RTEGSGQADGREGVM----VTA-TH----VNGSVIAG---GTSSQVSPVP
A0A3B3ZMX9_BCL2L1-      QSDTEHLGLGDRGVDRARLQRE-TE----VDSTELRL---DSASDSAPVH
G3NJY1_BCL2L1-01        RTGG-----GVEAGAAGGQRGA-TH----SNGTFNGT---S---PGTPPA
A0A2U9BY16_BCL2L1-      QTDR-----GEAGLG-EEQQTA-PH----ANGTLNGV---N---PGTPPE
A0A3Q3DUT7_BCL2L1-      RTDG-----REEASGEEEQRVQ-TP----ANGTTNGT---S------PPA
A0A3Q3DUT7_BCL2L1-      RTDG-----REEASGEEEQRVQ-TP----ANGTTNGT---S------PPA
A0A3Q3DUT7_BCL2L1-      RTDG-----REEASGEEEQRVQ-TP----ANGTTNGT---S------PPA
A0A3B1JJ42_BCL2L1-      RTEG-----GQEAEG-NAEAAG-VTPTAVVNGSVNGT---SHGAAGSPTS
A0A3P8UWG7_BCL2L1-      RTDG-----EEAGLG-AEQRTS-TH----ANGTVNGT---S---SGTPPA
A0A3Q3IVF5_BCL2L1-      RTDG-----EEA-----------TH----ANGTFNGT---S---PGTPPA
A0A3Q1DHJ3_BCL2L1-      RTDG-----GEARLG-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3Q1DHJ3_BCL2L1-      RTDG-----GEARLG-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3Q1DHJ3_BCL2L1-      RTDG-----GEARLG-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3P8TL99_BCL2L1-      RTDG-----GEARLG-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3P8TL99_BCL2L1-      RTDG-----GEARLG-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3Q1FR00_BCL2L1-      RTDG-----GEARLG-EDQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3B4Z3X2_BCL2L1-      RTDG-----GEARLA-EEQRTE-TH----ANGTFNGT---S---PGTPPP
A0A3B4Z3X2_BCL2L1-      RTDG-----GEARLA-EEQRTE-TH----ANGTFNGT---S---PGTPPP
C3VIT1_BCL2L1-01        RTGA-----GDGGLG-EEQSTE-TH----ANGTFTGT---S---PGTPPV
A0A3P8P0F1_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3Q2X557_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3P9D632_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3P9D632_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3Q4N4B5_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3B4FNX1_BCL2L1-      RTDG-----GAAGLD-EEQRID-TH----ANGTFNGT---S---PGTPPA
A0A3Q2QPL9_BCL2L1-      DGGA-----RDAESD-EEQTAE-TH----ANGTVNGT---S---SGSPRR
A0A3B5PQJ0_BCL2L1-      GTAA-----GDVGMD-DEQTLE-TH----ANGTFNGT---S---PGSPRR
A0A087X9B7_BCL2L1-      GDAA-----GDAGMD-DEQTLE-TH----ANGTFNGT---S---PGSPRR
A0A3B3TUS7_BCL2L1-      GDAA-----GDAGMD-DEQTLE-TH----ANGTFNGT---S---PGSPRR
A0A3B3WI27_BCL2L1-      GDAA-----GDAGMD-DEQTLE-TH----ANGTFNGT---S---PGSPRR
A0A3P9N9Y4_BCL2L1-      RDAA-----GDGGMD-DEQTLE-TH----ANGTFNGT---S---PGSPRR
A0A3Q3BEB7_BCL2L1-      RTE--------------KASSA-PSNGLLVNSRDGQS-------------
A0A3P8VMA1_BCL2L1-      QREG------------EEVTTA-SSNGVPQTPSAVLQ-------------
A0A345BSW9_BCL2L1-      RTDG------------AEENGE-GAAGTTTLVNGSMN-------RTPPQS
A0A286MU87_BCL2L1-      RTDG------------DEAIAN-GSVGNYR--NSRSN-------LAKPSS
A0A3P8XFS0_BCL2L1-      RTEG------------EEATAN-GSVGNGR--NSRRN-------LGKPST
A0A3P8XFS0_BCL2L1-      RTEG------------EEATAN-GSVGNGR--NSRRN-------LGKPST
A0A0F7L1T6_BCL2L1-      RTEG------------EKRSPA-ASNGLLVRSRNRGG---------ASPS
H2U5I3_BCL2L1-01        RTEG------------EKRSPA-ASNGLLVRSRNRGG---------ASPS
A0A3Q3J5K3_BCL2L1-      RTEG------------DRTNPA-TTNGLG---------------------
A0A3Q1EVP6_BCL2L1-      RTDG------------DKASSA-SSNGLLVN--NRDG-------------
A0A3Q1BQA0_BCL2L1-      RTDG------------DKANSA-SSNGLLVN--SRGG-------------
A0A3P8U812_BCL2L1-      RTDG------------DKANSA-SSNGLLVN--SRGG-------------
E6ZFR0_BCL2L1-01        RTEG------------DKANSA-ARNGLLASKNTSGQ-------PGTSSS
G3P7B4_BCL2L1-01        RTEG------------DKANSA-SVPGRGSSAGQPGM-------SSPPPP
A0A3Q3X5M5_BCL2L1-      RTEG------------DKASSA-ARNGLLVNSSSRGG---------LSPS
A0A2U9BIG9_BCL2L1-      RTEG------------DKANSA-ASNGLLVDGGNRCG---QLGTDPLPPD
A0A3B3E2W4_BCL2L1-      QTAEDR---------------S-AT----CNGTLVNS-------------
A0A3B3I2Q5_BCL2L1-      ETEEDH---------------S-DA----RNRRLVSS-------------
A0A3P9I2N4_BCL2L1-      ETEEDH---------------S-AA----RNGRQVSS-------------
A0A3P9MKK4_BCL2L1-      ETEEDH---------------S-AA----RNGRPVSS-------------
A0A3B5B4X7_BCL2L1-      RTEGDKTN-------------S-AA----SNGLLVNS-------------
A0A3B4BFZ8_BCL2L1-      QCEGNKAA-------------N-VP-----NGMLTNR-N-GNRQTLASLP
A0A3Q3FUB6_BCL2L1-      RTEGDMEN-------------S-AA----SNGFLVNS-RNRAGQSVMSSS
A0A3B5MGS2_BCL2L1-      RTNWEGDS-------------R-VP----RNGPLVNS---WAGHPGKPRG
M4A558_BCL2L1-01        RTNWEGDS-------------R-VP----SNGRLVNS---RAGPPGKPRG
A0A3P9QFB3_BCL2L1-      RTNWDGDS-------------R-GP----SNGPLVNS---RAGSRGKSQG
A0A087YBW4_BCL2L1-      RTNWDGDS-------------R-GP----SNGPLVNS---WAGSPGKSRD
A0A3B3VWI7_BCL2L1-      RTNWDGDS-------------R-GP----SNGPLVNS---WAGSPGKSRD
A0A3B3XN57_BCL2L1-      RTNWDGDS-------------R-GP----SNGPLVNS---WAGSPGKSQD
A0A3Q2C6K4_BCL2L1-      RTEGDKDA-------------S-AS----SNGPLFNS---RPSPPGKPRA
A0A3Q2NRP4_BCL2L1-      RTEGDKDS-------------P-AS----SNGPLVSS---WAGSPWQPWA
A0A0B4KJI5_BCL2L1-      RTEADKAN-------------S-AA----TNGLLANS-SNGGGQPGAD--
A0A3Q1JZ46_BCL2L1-      --VGDRPN-------------S-AA----ANGLPVS----RSGELGNSSP
A0A3Q1JZ46_BCL2L1-      --VGDRPN-------------S-AA----ANGLPVS----RSGELGNSSP
A0A3Q3NFM4_BCL2L1-      RTEGDMTG-------------A-AA----TNGLLVNS-RYVSGRPGMSSS
A0A3Q3NFM4_BCL2L1-      RTEGDMTG-------------A-AA----TNGLLVNS-RYVSGRPGMSSS
A0A3B4V9K8_BCL2L1-      RTEGDKAN-------------S-AA----SNGLLVNS-SDRCGQPGTSSP
A0A3B4XS24_BCL2L1-      RTEGDKAS-------------S-AA----SNGLLVNS-SDRCGQPGTSSP
A0A2U9BY16_BCL2L1-      RTDRGEAGLGEEQQT------A-PH----ANGTLNGV---NPG--TPPES
C1BLI0_BCL2L1-01        RTNVDKTN-------------V-SP----VNGSVEND-RNCIGSLGISSS
C0HAD8_BCL2L1-01        RTEGDD-----------------AI----ANGSVGNS-RS---NLAKPSS
A0A3B3ZMX9_BCL2L1-      LEDGTEIDTERDRDL------L-GL----GDRSVDRN--------STPSL
A0A3B3TFR4_BCL2L1-      QTGGGEGEAAGA---------V-AH----ANGSVSSGNSVGQG--APLEG
H3CH49_BCL2L1-01        RTEGQFG--------------T-TQ----SNGTFNGA---SPG--TPPAP
A0A3Q2FR43_BCL2L1-      GTGAQGAEQDDERTP------E-TH----ANGTFNGT---SPG--SP---
A0A3P8XYL5_BCL2L1-      RTEGGEVEEVAAV--------T-MH----PNGTMNGT--SPGT--PTQQS
Q90Z98_BCL2L1-02        RTDGAEENGEGAAGA------T-TL----VNGTMNRTNASSTG--TPPQS
Q90Z98_BCL2L1-01        RTDGAEENGEGAAGA------T-TL----VNGTMNRTNASSTG--TPPQS
A0A059PJI5_BCL2L1-      ----GQVAEENAVGAGESETPT-AV----VNGTLNGT--GSAG--TPPRS
A0A3B4DTL9_BCL2L1-      RTEGGQAAEENAEGA--AVTPT-AV----VNGSVNGT--SHG----PAGS
B5XAY3_BCL2L1-01        RTEVGQVE--GGAAV------L-TY----VNGTSPGT---PPPRQSPPSS
W5MG74_BCL2L1-01        RTGGAEAVGSGSPNA------E-ER----TNGAANGG---GGP--VSRQP
A0A3Q3B3X5_BCL2L1-      RTDAGDAGLEDAEMT------E-TH----ANGTFNGT---SPG--TPPAS
A0A3B3IB64_BCL2L1-      RTAAGEVG--EEQST------E-TH----ANGTFNGT---TPG--TPPLS
A0A3P9JYH1_BCL2L1-      RTAAGEVG--EEQST------E-TH----ANGTFNGT---TPG--TPPLS
A0A3B3DHA1_BCL2L1-      RTAAGEVG--EEQST------E-TH----ANGTFNGT---SPG--TPPLS
A0A3Q0RTF8_BCL2L1-      RTDGGAAGLDEEQRI------D-TH----ANGTFNGT---SPG--TPPAS
I3IZK7_BCL2L1-01        RTDGGAAGLDEEQRI------D-TH----ANGTFNGT---SPG--TPPAS
A0A2U9BY16_BCL2L1-      RTDRGEAGLGEEQQT------A-PH----ANGTLNGV---NPG--TPPES
A0A2U9BY16_BCL2L1-      RTDRGEAGLGEEQQT------A-PH----ANGTLNGV---NPG--TPPES
A0A2U9BY16_BCL2L1-      RTDRGEAGLGEEQQT------A-PH----ANGTLNGV---NPG--TPPES
A0A0D6DR75_BCL2L1-      RTDGGEVESAEEQRI------A-TH----ANGTFNGR---SPG--TPPAS
A0A3Q3WIW8_BCL2L1-      RTEGGQAVSDEEQRV------A-TH----ANGTFNGT---SPG--TPPRS
A0A219P0Y3_BCL2L1-      RTDGGEAGLGEEQRV------A-TH----ANGTFNGM---SPG--TPPAS
A0A3Q3MX20_BCL2L1-      RTDGGEAESGEEQRI------A-TH----ANGTFNGT---SPG--TPPAS
A0A3Q3G2E1_BCL2L1-      RTDGAGAGSGEEQQV------A-TH----ANGTFNGT---SPG--TPPAS
A0A3Q3G2E1_BCL2L1-      RTDGAGAGSGEEQQV------A-TH----ANGTFNGT---SPG--TPPAS
A0A3Q3G2E1_BCL2L1-      RTDGAGAGSGEEQQV------A-TH----ANGTFNGT---SPG--TPPAS
A0A3Q1GZ93_BCL2L1-      RTDGGEDGLSEEQRI------A-TH----ANGTFNGR---SPG--TPPAS
A0A3Q1GZ93_BCL2L1-      RTDGGEDGLSEEQRI------A-TH----ANGTFNGR---SPG--TPPAS
A0A3Q1GZ93_BCL2L1-      RTDGGEDGLSEEQRI------A-TH----ANGTFNGR---SPG--TPPAS
A0A3B4V3T1_BCL2L1-      RTDGGEAGLVEEQRI------A-TH----ANGTFNGT---SPG--TRAES
A0A3B4XU17_BCL2L1-      RTDGGEAGLVEEQRI------A-TH----ANGTFNGT---SPG--TRPES
H3ANS8_BCL2L1-01        DRAREAQTPEEGAIPGMDPPNG-SH----PHAGLNGA--------VNGLP
A0A452FHY1_BCL2L1-      SLRRDKIRYGNPNAVNANPSWH-LA----HSPAVNGA-------------
A0A452FHY1_BCL2L1-      SLRRDKIRYGNPNAVNANPSWH-LA----HSPAVNGA-------------
A0A1S3EPX7_BCL2L1-      DPEGTESEMETPSAINGNPSWHLAD----SPAVVNGA-------------
A0A218USB3_BCL2L1-      DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
A0A218USB3_BCL2L1-      DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
U3JSL7_BCL2L1-01        DFAGEEDEMD--GVLNGSPSWH-AP----TSHIVNGA-------------
A0A218USB3_BCL2L1-      DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
A0A218USB3_BCL2L1-      DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
H0Z8G3_BCL2L1-01        DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
Q4U2V6_BCL2L1-01        DFAGEEDEMD--GVLNGSPSWH-AA----TSHIVNGA-------------
                                                                          

A0A3Q1FR00_BCL2L1-      ----------------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
R4JQR8_BCL2L1-01        ----------------PSQIQLKLRSLGDEFQERFQTQFDDMVNQLHI--
A0A346RRN1_BCL2L1-      ----------------PSQVQLTLRTIGDEFQERFRTQFDDMVDQLHI--
Q2TAP5_BCL2L1-01        ----------------EEEVLQALLEATEEFELRYQRAFSDLTSQLHI--
Q91828_BCL2L1-01        ----------------EEEVLQALLEATEEFELRYQRAFSDLTSQLHI--
I7GKS6_BCL2L1-01        ----------------LRPQKGLNR-----------RWRPPVPSMATHPG
A0A2K5EBP4_BCL2L1-      ----------------LRPQKGLIR-----------RWRPPVPSMLHI--
A0A2K5Q6R6_BCL2L1-      ----------------LRPQKGLIR-----------RWRPPVPSMLHI--
A0A2K6UWY8_BCL2L1-      ----------------LRPQKGLIR-----------RWRPPVPSMLHI--
A0A2K5M8B1_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A2K5H963_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A2K5VPG2_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A2K5YR37_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A2R8Z9D7_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A096NV05_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A2K6QFA2_BCL2L1-      ----------------------MWKRTGLRPQKGLNRRWRPPVPSMAT--
A0A1U7T4L4_BCL2L1-      ----------------------MWKRTGLRPQKGLSRRWRPPVPSMAT--
A0A2K6G3C5_BCL2L1-      ----------------------MQKRTGLRPQKRLNRRWRPPVPLMAT--
A0A3Q1LRT3_BCL2L1-      ----------------MTTVKQALREASNEFKLRYQQTFSDLMSQLRI--
H9GHK7_BCL2L1-01        ----------------RVDVSQTLREAGDEFELRYRRAFSDLTSQLHI--
Q07816_BCL2L1-04        ----------------ASDVRQALRDAGDEFELR--GFVRGERGQGDA--
A0A493TIA6_BCL2L1-      ----------------SAAVRQALREAGDEFELRYRRAFSDLTSQLHI--
Q07816_BCL2L1-02        ----------------ASDVRQALRDAGDEFELRYRRAFSDLTSQLHI--
Q07816_BCL2L1-03        ----------------ASDVRQALRDAGDEFELRYRRAFSDLTSQLHI--
Q07816_BCL2L1-01        ----------------ASDVRQALRDAGDEFELRYRRAFSDLTSQLHI--
G1N5N5_BCL2L1-01        ----------------ASDVRQTLRDAGDEFELRYRRAFSDLTSQLHI--
A0A452ILL8_BCL2L1-      ----------------ATGVRQALREAGDEFELRYRRAFSDLTSQLHI--
A0A452ILL8_BCL2L1-      ----------------ATGVRQALREAGDEFELRYRRAFSDLTSQLHI--
K7F655_BCL2L1-01        ----------------AAEVRQALREAGDEFELRYRRAFSDLTSQLHI--
A0A452E1B1_BCL2L1-      ----------------TAVVKQALREASNECELRYQQTFSDLTSQLHI--
W5PSA5_BCL2L1-01        ----------------MAVVKQALREASNECELRYQQTFSDLTSQLHI--
P53563_BCL2L1-03        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
P53563_BCL2L1-02        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A287CZ07_BCL2L1-      ----------------MAAVKQALREAGDEFELWYWRAFSDLTSQLHI--
F6WA14_BCL2L1-01        ----------------VAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G3WKX6_BCL2L1-01        ----------------VAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
M3XA94_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
M3XA94_BCL2L1-02        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A3Q2H0F6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
H0X6V2_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G3SPN0_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q2PFS6_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
O35843_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
M3XA94_BCL2L1-03        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G1RER8_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A1S2ZQT6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q64373_BCL2L1-09        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q64373_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
P53563_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
O77737_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q9MYW4_BCL2L1-01        ----------------MTAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A3Q2H0F6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
L8J061_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q05KJ0_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q05KJ0_BCL2L1-02        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
E2IV76_BCL2L1-01        ----------------MAAVKQALKEAGDEFELRYRRAFSDLTSQLHI--
A0A2K6G3C5_BCL2L1-      ----------------MAAVKQALKEAGDEFELRYRRAFSDLTSQLHI--
B2Z3Z4_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G3HEA7_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G3HEA7_BCL2L1-02        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A1U7T4L4_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
M3Z2H9_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A1U7QU73_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A0D9RJZ8_BCL2L1-      ----------------MAAVKQTLREAGDEFELRYRRAFSDLTSQLHI--
A0A286Y5D6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A250YD48_BCL2L1-      ----------------MTAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A1L5BWY3_BCL2L1-      ----------------MTAVKQALREAGDEFELRYRRAFSDLTSQLHI--
I3MUP5_BCL2L1-02        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
I3MUP5_BCL2L1-03        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
I3MUP5_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
G1P9D2_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5EBP4_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
E2IV75_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
F7IT34_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q76LT7_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5Q6R6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5Q6R6_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5M8B1_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5H963_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q8SQ42_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5VPG2_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K5YR37_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2R8Z9D7_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A096NV05_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2J8VIH3_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K6QFA2_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K6QFA2_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A2K6UWY8_BCL2L1-      ----------------MAAIKQALREAGDEFELRYRRAFSDLTSQLHI--
E2IV77_BCL2L1-01        ----------------MAAIKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A452SDS4_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A384D3U1_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A452FWV3_BCL2L1-      ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
Q9MZS7_BCL2L1-01        ----------------MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
D2ITA2_BCL2L1-02        ----------------TEAVRAALLESVEEFELRYTLAFSDLSSQLPI--
A0A3P9MKK4_BCL2L1-      ----------------MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3B3I2Q5_BCL2L1-      ----------------MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3P9I2N4_BCL2L1-      ----------------MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3B3QRZ2_BCL2L1-      EQPLHSPSPSPQG---LEAVKEALRDSANEFELRYSRAFSDLSSQLHI--
A0A3B3ZMX9_BCL2L1-      SPAPLLD---------LDAVKEALRDSANEFELRFSRAFSDLHRQLHI--
G3NJY1_BCL2L1-01        SPLLQQRSPSTAS---LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A2U9BY16_BCL2L1-      SPLRLQRLPSSPS---LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3Q3DUT7_BCL2L1-      SPLREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQLHI--
A0A3Q3DUT7_BCL2L1-      SPLREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQLHI--
A0A3Q3DUT7_BCL2L1-      SPLREAAS--------LDAVKEALRDSANEFELRYSHAFSDLDKQLHI--
A0A3B1JJ42_BCL2L1-      SPQRRANGARG-----LDAVKEALRDSANEFELRYSRAFSDLSSQLHI--
A0A3P8UWG7_BCL2L1-      SPLRQQHSASDTS---LDSIKEALRDSANEFELRYARAFSDLHQQLHI--
A0A3Q3IVF5_BCL2L1-      SPLRQQQLPSTAN---LDAVKEALRDSANEFELRYARAFSDLHHQLHI--
A0A3Q1DHJ3_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q1DHJ3_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q1DHJ3_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3P8TL99_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3P8TL99_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q1FR00_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3B4Z3X2_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3B4Z3X2_BCL2L1-      SPRRLASTAT------MDAVKEALRDTANEFELRYARAFSDLHSQLHI--
C3VIT1_BCL2L1-01        SPLRQQPLPSTTTTTRLDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3P8P0F1_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q2X557_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3P9D632_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3P9D632_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q4N4B5_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3B4FNX1_BCL2L1-      SPQRRQQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3Q2QPL9_BCL2L1-      RQQQPASTAA------MEAVKVALRETACEFELRYARAFNDLHSTLHI--
A0A3B5PQJ0_BCL2L1-      --HQAASAST------MDAVKVALRDTAREFELRYSRAFNDLHSTLHI--
A0A087X9B7_BCL2L1-      --QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHSTLHI--
A0A3B3TUS7_BCL2L1-      --QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHSTLHI--
A0A3B3WI27_BCL2L1-      --QQAASAAT------MDAVKVTLRDTAREFELRYSRAFNDLHSTLHI--
A0A3P9N9Y4_BCL2L1-      --QQAASAST------MDAVKVTLRDTAREFELRYSRAFNDLHSTLHI--
A0A3Q3BEB7_BCL2L1-      ----GKKIWPRRSD--IEAVKSALKDSADEFERLYTQSFSHLSLQLDI--
A0A3P8VMA1_BCL2L1-      ----------HCSG--AEAVKAALKDSADEFELRFTQAFRNLFLKLDL--
A0A345BSW9_BCL2L1-      PATSPQHQTNGSGG--LDAVKEALRDSANEFELRYSRAFNDLSSQLHI--
A0A286MU87_BCL2L1-      P----------QGG--MEPVKAALRDSVDEFELRYTRAFSDLSSQLHI--
A0A3P8XFS0_BCL2L1-      P----------QGC--MEAVKAALRDSADEFELRYTRAFSDLSSQLHI--
A0A3P8XFS0_BCL2L1-      P----------QGC--MEAVKAALRDSADEFELRYTRAFSDLSSQLHI--
A0A0F7L1T6_BCL2L1-      A----------GAG--IEAVNAALRDSAEEFEKLFAQAFSDLSSQLDI--
H2U5I3_BCL2L1-01        A----------GAG--IEAVNAALRDSAEEFEKLFAQAFSDLSSQLDI--
A0A3Q3J5K3_BCL2L1-      ----------------IEAVKAALRDSADEFELRFTQAFSDLSSQLVI--
A0A3Q1EVP6_BCL2L1-      ----------------IEAVKSTLKDAADEFELLFTQTFSDLSSQIDI--
A0A3Q1BQA0_BCL2L1-      ----------------IEAVKSALKDAADEFELLFTQAFSDLSSQLDI--
A0A3P8U812_BCL2L1-      ----------------IEAVKSALKDAADEFELLFTQAFSDLSSQLDI--
E6ZFR0_BCL2L1-01        S----------GAD--IEAVKAALRDSADEFELLFTQAFSDLSSQIDI--
G3P7B4_BCL2L1-01        P----------SGD--TEAVKAALQDSANEFELLFTQAFSDLSLQLDV--
A0A3Q3X5M5_BCL2L1-      T----------GAD--MEAVKSALRDSANEFEQLFTQAFSDLSSQLDI--
A0A2U9BIG9_BCL2L1-      G----------G----VGAVKEALRDSAHEFEQLFNQAFSDLSLQLDI--
A0A3B3E2W4_BCL2L1-      EDGQLKKSCPCCAS--MDAIKSTLKDSANEFERRFSQGFSDLSLQFHI--
A0A3B3I2Q5_BCL2L1-      EDGRLRRSCPCCAS--MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3P9I2N4_BCL2L1-      EDGQLRRSCPCCAS--MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3P9MKK4_BCL2L1-      EDCQLRRSCPCCAS--MDAIKSTLKDSADEFERRFHQGFSDLSVQLHI--
A0A3B5B4X7_BCL2L1-      -RG----------G--IEAVKAALKDSADEFELLFTQAFSDLSSQLDI--
A0A3B4BFZ8_BCL2L1-      PDD----------H--LDAIKTALTDSADEFEELFTQAFSNLSSQLDI--
A0A3Q3FUB6_BCL2L1-      PHT----------D--IEAVKAALLDSADEFELLFTQAFSDLSSQLDI--
A0A3B5MGS2_BCL2L1-      PPA----------G--VEVVKSVLKDAAEEFERLYTQSFKHLSLQLDI--
M4A558_BCL2L1-01        PMA----------G--VEVVKSVLKDAAEEFERLYTQSFKHLSLQLDI--
A0A3P9QFB3_BCL2L1-      PP--------------VEVVKSVLKDAAEEFERLYTQSFKHLSLQLDI--
A0A087YBW4_BCL2L1-      PPT----------G--VKVVKLVLKDAAEEFERLYTQSFKHLSLQLDI--
A0A3B3VWI7_BCL2L1-      PPT----------G--VKVVKLVLKDAAEEFERLYTQSFKHLSLQLDI--
A0A3B3XN57_BCL2L1-      PPT----------G--VEVVKSVLKDAAEEFERLYTQSFKHLSLQLDI--
A0A3Q2C6K4_BCL2L1-      PHG----------S--IEAVKSALKDSANEFELLFSQSFSDLSMQLDI--
A0A3Q2NRP4_BCL2L1-      PHG----------R--AEAVKSALRDSADEFEHLFTQSFSHLSLQLDI--
A0A0B4KJI5_BCL2L1-      ----------------IEAVKAALRDSSEEFELLFTQAFSDLSTQLDI--
A0A3Q1JZ46_BCL2L1-      PCK----------S--MEAVKTALRDSADEFELLFTQAFSDLSSQLDV--
A0A3Q1JZ46_BCL2L1-      PCK----------S--MEAVKTALRDSADEFELLFTQAFSDLSSQLDV--
A0A3Q3NFM4_BCL2L1-      PHG----------G--VEAVKAALRDSAEEFELLFTQAFSDLSSQLDI--
A0A3Q3NFM4_BCL2L1-      PHG----------G--VEAVKAALRDSAEEFELLFTQAFSDLSSQLDI--
A0A3B4V9K8_BCL2L1-      PHG----------G--IEAVKSALKDSADEFELLFNQAFSDLSTQLDI--
A0A3B4XS24_BCL2L1-      PHG----------G--IEAVKSALKDSADEFELLFNQAFSDLSTQLDI--
A0A2U9BY16_BCL2L1-      PLR--LQRLPSSPS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
C1BLI0_BCL2L1-01        PQG----------G--IEAVKAALRDSADEFELRYTRAFNDPSSQLHI--
C0HAD8_BCL2L1-01        PQG----------G--MEPVKAALRDSVDEFELRYTRAFSDLSSQLHI--
A0A3B3ZMX9_BCL2L1-      RLR--------LDS--ASDSAPALRDSANEFELRFSRAFSDLHRQLHI--
A0A3B3TFR4_BCL2L1-      ATP---------QG--LEAVKEALRLSANEFEFRYQRAFSDLSSQLHI--
H3CH49_BCL2L1-01        -----SQHQQSLTS--LDAVKEALRDTGNEFELRYTCAFSDLHNQLHI--
A0A3Q2FR43_BCL2L1-      -----RRQQASTAA--MEAVKAALRDTACEFELRYARAFNDLHSTLHI--
A0A3P8XYL5_BCL2L1-      PPSSPRRTV----G--LDAVKEALRDSANEFELRYALAFSDLSSQLHL--
Q90Z98_BCL2L1-02        PASSPQRQTNGSGG--LDAVKEALRDSANEFELRYSRAFNDLSSQLHI--
Q90Z98_BCL2L1-01        PASSPQRQTNGSGG--LDAVKEALRDSANEFELRYSRAFNDLSSQLHI--
A0A059PJI5_BCL2L1-      PTLSPQRQVNGSAS--LEAVKEALRDSGNEFELRYSRAFSDLSSQLHI--
A0A3B4DTL9_BCL2L1-      PTSSPQRRSNGAGG--LDAVKEALRDSANEFELRYSRAFSDLSSQLHI--
B5XAY3_BCL2L1-01        PRR--------TAG--LDAVKEALRDSANEFELRYARAFSDLSSQLHI--
W5MG74_BCL2L1-01        PQG-------------IEAVQGALRDSANEFELRYGRAFSDLSSQLHI--
A0A3Q3B3X5_BCL2L1-      PLR--QQPLPTTAN--MDKVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A3B3IB64_BCL2L1-      PLR--EQQLPSTTN--MDAVKEALRDTANEFELRYALAFNNLHSQLHI--
A0A3P9JYH1_BCL2L1-      PLR--EQQLPSTTN--MDAVKEALRDTANEFELRYALAFNNLHSQLHI--
A0A3B3DHA1_BCL2L1-      PLR--QQQLPSTTN--MDAVKEALRDTANEFELRYALAFNNLHSQLHI--
A0A3Q0RTF8_BCL2L1-      PQR--QQQPPSTTN--LDAVKEALRDTANEFELRYARAFNDLHSQLHI--
I3IZK7_BCL2L1-01        PQR--QQQPPSTTD--LDAVKEALRDTANEFELRYARAFSDLHSQLHI--
A0A2U9BY16_BCL2L1-      PLR--LQRLPSSPS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A2U9BY16_BCL2L1-      PLR--LQRLPSSPS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A2U9BY16_BCL2L1-      PLR--LQRLPSSPS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A0D6DR75_BCL2L1-      PLR--QQRLPSPTS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3Q3WIW8_BCL2L1-      PLR----LQPSTTS--LDAVKDALRDSANEFELRYARAFSDLHNQLHI--
A0A219P0Y3_BCL2L1-      PLR--QQQLPSTTS--LDAVKEALRDSANEFELRYARAFSDLHHQLHI--
A0A3Q3MX20_BCL2L1-      PLR--QEHLQSTAS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3Q3G2E1_BCL2L1-      PHRQQQQRLPATTN--LDAVKEALRDSANEFELRYASAFSDLHNQLHI--
A0A3Q3G2E1_BCL2L1-      PHRQQQQRLPATTN--LDAVKEALRDSANEFELRYASAFSDLHNQLHI--
A0A3Q3G2E1_BCL2L1-      PHRQQQQRLPATTN--LDAVKEALRDSANEFELRYASAFSDLHNQLHI--
A0A3Q1GZ93_BCL2L1-      PLR--QQRLPSTTS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3Q1GZ93_BCL2L1-      PLR--QQRLPSTTS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3Q1GZ93_BCL2L1-      PLR--QQRLPSTTS--LDAVKEALRDSANEFELRYARAFSDLHNQLHI--
A0A3B4V3T1_BCL2L1-      PQR--QQRLPSTTS--LDAVKEALRDSANEFELRYSRAFSDLHNQLHI--
A0A3B4XU17_BCL2L1-      PQR--QQRLPSTTS--LDAVKEALRDSANEFELRYSRAFSDLHNQLHI--
H3ANS8_BCL2L1-01        AGSSSRLEAQAVSG--PEAVKRTLREAGEEFELRYSRAFSDLSSQLHI--
A0A452FHY1_BCL2L1-      TGHTE-----ESGP--VATAQQAPREAGSEFELRHQQTVSDLTSQLHT--
A0A452FHY1_BCL2L1-      TGHTE-----ESGP--VATAQQAPREAGSEFELRHQQTVSDLTSQLHT--
A0A1S3EPX7_BCL2L1-      TGHSSSSEAREVIP--MAAVKQALREAGDEFELRYRRAFSDLTSQLHI--
A0A218USB3_BCL2L1-      TVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
A0A218USB3_BCL2L1-      TVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
U3JSL7_BCL2L1-01        SVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
A0A218USB3_BCL2L1-      TVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
A0A218USB3_BCL2L1-      TVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
H0Z8G3_BCL2L1-01        TVHQNSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
Q4U2V6_BCL2L1-01        TVHQSSLEVHEIRR--AADVRQALREAGDEFELRYRRAFSDLTSQLHI--
                                                                          

A0A3Q1FR00_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
R4JQR8_BCL2L1-01        TEATAYPTFQRVVQELFIDGNINWGRIVALFGFGGSLS----------VK
A0A346RRN1_BCL2L1-      TEATAYPTFQRVVQELFIDGNINWGRVVALFGFGGALS----------VE
Q2TAP5_BCL2L1-01        TQDTAQQSFQQVMGELFRDG-TNWGRIVAFFSFGRALC----------VE
Q91828_BCL2L1-01        TQDTAQQSFQQVMGELFRDG-TNWGRIVAFFSFGRALC----------VE
I7GKS6_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5EBP4_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5Q6R6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6UWY8_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5M8B1_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5H963_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5VPG2_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5YR37_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2R8Z9D7_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A096NV05_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6QFA2_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A1U7T4L4_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6G3C5_BCL2L1-      HPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A3Q1LRT3_BCL2L1-      TPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTLC----------MK
H9GHK7_BCL2L1-01        TLGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC----------VE
Q07816_BCL2L1-04        GTGGTHCVLDDHVLDRPSRS-LDPGEWRL-----GALCGSVWEQRCCRAE
A0A493TIA6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q07816_BCL2L1-02        TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC----------VE
Q07816_BCL2L1-03        TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC----------VE
Q07816_BCL2L1-01        TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC----------VE
G1N5N5_BCL2L1-01        TPGTAYQSFEQVVNELFHDG-VNWGRIVAFFSFGGALC----------VE
A0A452ILL8_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A452ILL8_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
K7F655_BCL2L1-01        TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A452E1B1_BCL2L1-      TPGTTYQSFEQVINELFQDG-VNWCRNVAFFSFGGALC----------MK
W5PSA5_BCL2L1-01        TPGKAYQSFEQVINELFQDG-VNWGRNVAFFSFGGALC----------MK
P53563_BCL2L1-03        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
P53563_BCL2L1-02        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A287CZ07_BCL2L1-      TLGTAYQSFEQVVNELFRDG-VNWGHIVAFLSFGGALC----------ME
F6WA14_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G3WKX6_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
M3XA94_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
M3XA94_BCL2L1-02        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A3Q2H0F6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
H0X6V2_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G3SPN0_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q2PFS6_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
O35843_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
M3XA94_BCL2L1-03        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G1RER8_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A1S2ZQT6_BCL2L1-      TPATAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q64373_BCL2L1-09        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q64373_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
P53563_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
O77737_BCL2L1-01        TPGTAYQSFEQVLNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q9MYW4_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A3Q2H0F6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
L8J061_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q05KJ0_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q05KJ0_BCL2L1-02        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
E2IV76_BCL2L1-01        TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6G3C5_BCL2L1-      TLGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
B2Z3Z4_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G3HEA7_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G3HEA7_BCL2L1-02        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A1U7T4L4_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
M3Z2H9_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A1U7QU73_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A0D9RJZ8_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A286Y5D6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A250YD48_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A1L5BWY3_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
I3MUP5_BCL2L1-02        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
I3MUP5_BCL2L1-03        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
I3MUP5_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
G1P9D2_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5EBP4_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
E2IV75_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
F7IT34_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q76LT7_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5Q6R6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5Q6R6_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5M8B1_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5H963_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q8SQ42_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5VPG2_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K5YR37_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2R8Z9D7_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A096NV05_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2J8VIH3_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6QFA2_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6QFA2_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A2K6UWY8_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
E2IV77_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A452SDS4_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A384D3U1_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A452FWV3_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q9MZS7_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
D2ITA2_BCL2L1-02        TPATAYGSFESVMDEVFRDS-INWGRIVGLFAFGGALC----------VE
A0A3P9MKK4_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3B3I2Q5_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3P9I2N4_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3B3QRZ2_BCL2L1-      TPVTAYQSFESVMNEVFRDG-INWGRIVGLFAFGGALC----------VE
A0A3B3ZMX9_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALA----------VE
G3NJY1_BCL2L1-01        TPATAYQSFEDVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A2U9BY16_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS----------VE
A0A3Q3DUT7_BCL2L1-      TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC----------VE
A0A3Q3DUT7_BCL2L1-      TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC----------VE
A0A3Q3DUT7_BCL2L1-      TPATAYQSFENVVDEVFQDD-VNWGRIVGLFAFGGALC----------VE
A0A3B1JJ42_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
A0A3P8UWG7_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIIGLFAFGGALS----------VE
A0A3Q3IVF5_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRIIGLFAFGGALC----------VE
A0A3Q1DHJ3_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1DHJ3_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1DHJ3_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P8TL99_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P8TL99_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1FR00_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B4Z3X2_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B4Z3X2_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
C3VIT1_BCL2L1-01        TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P8P0F1_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q2X557_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P9D632_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P9D632_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q4N4B5_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B4FNX1_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q2QPL9_BCL2L1-      TPATAYQSFENVMNEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B5PQJ0_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A087X9B7_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B3TUS7_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B3WI27_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P9N9Y4_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q3BEB7_BCL2L1-      SPDTVYHSFKSVLDELFKDG-VNWGRVVGLFAFGGVLC----------VQ
A0A3P8VMA1_BCL2L1-      TPDTVYHSFKSVMDEVFRDG-VNWGRIVGLFTFGGVLC----------VE
A0A345BSW9_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A286MU87_BCL2L1-      TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
A0A3P8XFS0_BCL2L1-      TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
A0A3P8XFS0_BCL2L1-      TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
A0A0F7L1T6_BCL2L1-      TPDTAYQSFKNVMDEVFKDG-DNWGRVVGLFAFGGVLC----------VE
H2U5I3_BCL2L1-01        TPDTAYQSFKNVMDEVFKDG-VNWGRVVGLFAFGGVLC----------VE
A0A3Q3J5K3_BCL2L1-      TPDTAYNSFKSVMDEVFKDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1EVP6_BCL2L1-      TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC----------VE
A0A3Q1BQA0_BCL2L1-      TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC----------VE
A0A3P8U812_BCL2L1-      TPETAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC----------VE
E6ZFR0_BCL2L1-01        TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
G3P7B4_BCL2L1-01        TPDTAYHSFKSVMDEVFKDG-VNWGRVVGLFAFGGVLC----------VE
A0A3Q3X5M5_BCL2L1-      TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A2U9BIG9_BCL2L1-      TPDTAYQSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3B3E2W4_BCL2L1-      TPDTAYQNFKSVLDELFKDG-INWGRVVGLFVFGGVLC----------VE
A0A3B3I2Q5_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3P9I2N4_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3P9MKK4_BCL2L1-      TPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFGGALC----------VE
A0A3B5B4X7_BCL2L1-      TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLC----------VE
A0A3B4BFZ8_BCL2L1-      TPDTAYNSFKSVMDEVFKDG-VNWGRIVGLFVFGGVLS----------VE
A0A3Q3FUB6_BCL2L1-      TPNTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3B5MGS2_BCL2L1-      TPDTAYHSFKTVLDELFKGG-VNWGRVVAMFTFGGILC----------VD
M4A558_BCL2L1-01        TPDTAYHSFKTVLDELFKGG-VNWGRVVAMFTFGGILC----------VD
A0A3P9QFB3_BCL2L1-      TPDTAYHSFKTVLDELFKGE-VNWGRVVAMFTFGGILC----------VD
A0A087YBW4_BCL2L1-      TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC----------VD
A0A3B3VWI7_BCL2L1-      TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC----------VD
A0A3B3XN57_BCL2L1-      TPDTAYQSFKTVLDELFKGE-VNWGRVVAMFTFGGILC----------VD
A0A3Q2C6K4_BCL2L1-      TPDTAYHSFKAVLDELFKDG-INWGRVVGLFAFGGVLC----------VH
A0A3Q2NRP4_BCL2L1-      TPDTAYHSFKAVLDELFKDG-VNWGRVVGLFAFGGVLC----------VD
A0A0B4KJI5_BCL2L1-      TPDTAYHSFKSVMDEVFKDG-VNWGRVVGLFAFGGVLC----------VE
A0A3Q1JZ46_BCL2L1-      TPDTAYQSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3Q1JZ46_BCL2L1-      TPDTAYQSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3Q3NFM4_BCL2L1-      TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3Q3NFM4_BCL2L1-      TPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3B4V9K8_BCL2L1-      TPDTAYHSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A3B4XS24_BCL2L1-      TPDTAYHSFKSVMDELFKDG-VNWGRIVGLFAFGGVLC----------VE
A0A2U9BY16_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS----------VE
C1BLI0_BCL2L1-01        TPATAYHSFESVMNEVFRDG-VNWGRVVGLFAFGGALC----------AE
C0HAD8_BCL2L1-01        TPATAYHSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
A0A3B3ZMX9_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALA----------VE
A0A3B3TFR4_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRVVGLFAFGGALC----------VE
H3CH49_BCL2L1-01        TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q2FR43_BCL2L1-      TPATAYQSFENVMNEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3P8XYL5_BCL2L1-      TPATAYQSFASVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
Q90Z98_BCL2L1-02        TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
Q90Z98_BCL2L1-01        TPATAYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A059PJI5_BCL2L1-      TPVTVYQSFESVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B4DTL9_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRVVGLFAFGGALC----------VE
B5XAY3_BCL2L1-01        TPSTAYQSFENVMDEVFRDG-VNWGRVVGLFSFGGALC----------VE
W5MG74_BCL2L1-01        TPATAYQSFEHVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q3B3X5_BCL2L1-      TPGTVYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B3IB64_BCL2L1-      TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC----------VE
A0A3P9JYH1_BCL2L1-      TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC----------VE
A0A3B3DHA1_BCL2L1-      TPATAYQSFENVMNELFRDN-INWGRIVGLFAFGGALC----------VE
A0A3Q0RTF8_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
I3IZK7_BCL2L1-01        TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A2U9BY16_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS----------VE
A0A2U9BY16_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS----------VE
A0A2U9BY16_BCL2L1-      TPATAYQSFESVMNEVFRDG-VNWGRIIGLFAFGGALS----------VE
A0A0D6DR75_BCL2L1-      TPATAYQSFANVMDEVFRDG-VNWGRIIGLFAFGGALC----------VE
A0A3Q3WIW8_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A219P0Y3_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q3MX20_BCL2L1-      TPATAYQSFESVMDEVFRDG-VNWGRIIGLFAFGGALC----------VE
A0A3Q3G2E1_BCL2L1-      TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q3G2E1_BCL2L1-      TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q3G2E1_BCL2L1-      TPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1GZ93_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1GZ93_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3Q1GZ93_BCL2L1-      TPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALC----------VE
A0A3B4V3T1_BCL2L1-      TPATAYQSFANVMDEVFRDG-FNWGRIIGLFVFGGALC----------VE
A0A3B4XU17_BCL2L1-      TPATAYQSFANVMDEVFRDG-FNWGRIIGLFVFGGALC----------VE
H3ANS8_BCL2L1-01        TPGTAYQSFEQVVNELFRDG-VNWGRVVAFFAFGGALC----------VE
A0A452FHY1_BCL2L1-      TPGTAYQSFEQVMYELFWDG-VNWDHTVAFFSFRGALC----------ME
A0A452FHY1_BCL2L1-      TPGTAYQSFEQVMYELFWDG-VNWDHTVAFFSFRGALC----------ME
A0A1S3EPX7_BCL2L1-      TPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A218USB3_BCL2L1-      TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A218USB3_BCL2L1-      TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
U3JSL7_BCL2L1-01        TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A218USB3_BCL2L1-      TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
A0A218USB3_BCL2L1-      TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
H0Z8G3_BCL2L1-01        TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
Q4U2V6_BCL2L1-01        TPSTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC----------VE
                            .   :   : :       .             *.            

A0A3Q1FR00_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQG-QGGW---E-----
R4JQR8_BCL2L1-01        CVQRGMPQLVDS-----IVDWVSTYLCNSLEQWITD-NGGW---Q-----
A0A346RRN1_BCL2L1-      CVQNGMPQLVDS-----IVDWVSVYLCDNLEPWITS-NGGW---Q-----
Q2TAP5_BCL2L1-01        SANKEMTDLLPR-----IVQWMVNYLEHTLQPWMQE-NGGW---E-----
Q91828_BCL2L1-01        SANKEMTDLLPR-----IVQWMVNYLEHTLQPWMQE-NGGW---E-----
I7GKS6_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5EBP4_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5Q6R6_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6UWY8_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5M8B1_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5H963_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5VPG2_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5YR37_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2R8Z9D7_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A096NV05_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6QFA2_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A1U7T4L4_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQD-NGGW---D-----
A0A2K6G3C5_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A3Q1LRT3_BCL2L1-      SIDKEIHVLVSQ-----VTTSTATYLNNHLKPWIQE-NGGW---D-----
H9GHK7_BCL2L1-01        SVDKEMQGLVVR-----IASWMTTYLTEHLDPWIQE-NGGW---------
Q07816_BCL2L1-04        EGPGDLQQMAPHRGDRGRSASAGIPAEPQVTPWLCPLAPGWLRLH-----
A0A493TIA6_BCL2L1-      SVDKEMRVLVGR-----IVAWMTTYLSDHLDPWIQE-NGGW---V-----
Q07816_BCL2L1-02        SVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
Q07816_BCL2L1-03        SVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
Q07816_BCL2L1-01        SVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
G1N5N5_BCL2L1-01        SVDKEMRVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
A0A452ILL8_BCL2L1-      SVDKEMQVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
A0A452ILL8_BCL2L1-      SVDKEMQVLVGR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
K7F655_BCL2L1-01        SVDKEMQVLVGR-----IASWMTTYLTDHLDPWIQE-NGGW---E-----
A0A452E1B1_BCL2L1-      SIVKEMQVLVSQ-----VTTWMATYLNNHLEPWIQE-NGDW---D-----
W5PSA5_BCL2L1-01        SIVKEMQVLVSQ-----VTTWMATYLNDHLEPWIQE-NGDW---D-----
P53563_BCL2L1-03        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGWVRTTPLVCP
P53563_BCL2L1-02        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGWVRTTPLVCP
A0A287CZ07_BCL2L1-      SVDKEMQVLVSR-----IASWM---------PWIQE-NGGW---D-----
F6WA14_BCL2L1-01        SVDKEMEVLVGR-----ITSWMATYLDDHLDPWIQE-NGGW---D-----
G3WKX6_BCL2L1-01        SVDKEMEVLVAR-----ITSWMATYLDEHLDPWIQE-NGGW---D-----
M3XA94_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGWVVIEHQRCA
M3XA94_BCL2L1-02        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A3Q2H0F6_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---KETALG
H0X6V2_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGWWRCQ-----
G3SPN0_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---V-----
Q2PFS6_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
O35843_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---G-----
M3XA94_BCL2L1-03        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---V-----
G1RER8_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A1S2ZQT6_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q64373_BCL2L1-09        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
Q64373_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
P53563_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
O77737_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q9MYW4_BCL2L1-01        SVDKEMEVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A3Q2H0F6_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
L8J061_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q05KJ0_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q05KJ0_BCL2L1-02        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
E2IV76_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6G3C5_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
B2Z3Z4_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW---D-----
G3HEA7_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW---D-----
G3HEA7_BCL2L1-02        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW---D-----
A0A1U7T4L4_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQD-NGGW---D-----
M3Z2H9_BCL2L1-01        SVDKEMQALVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A1U7QU73_BCL2L1-      SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQD-NGGW---D-----
A0A0D9RJZ8_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A286Y5D6_BCL2L1-      SVDKEMQVLVRR-----IASWMATYLNDHLEPWIQD-NGGW---D-----
A0A250YD48_BCL2L1-      SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
A0A1L5BWY3_BCL2L1-      SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
I3MUP5_BCL2L1-02        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
I3MUP5_BCL2L1-03        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
I3MUP5_BCL2L1-01        SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-NGGW---D-----
G1P9D2_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5EBP4_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
E2IV75_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
F7IT34_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
Q76LT7_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5Q6R6_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5Q6R6_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5M8B1_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5H963_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q8SQ42_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5VPG2_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K5YR37_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2R8Z9D7_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A096NV05_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2J8VIH3_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6QFA2_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6QFA2_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A2K6UWY8_BCL2L1-      SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
E2IV77_BCL2L1-01        SVDKEMQVLVSR-----IAAWMATYLNDHLEPWIQE-NGGW---D-----
A0A452SDS4_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A384D3U1_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
A0A452FWV3_BCL2L1-      SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
Q9MZS7_BCL2L1-01        SVDKEMQVLVSR-----IATWMATYLNDHLEPWIQE-NGGW---D-----
D2ITA2_BCL2L1-02        CVEKEMSHMVPR-----VAEWMTRYLDDHIDHWIQS-NGGW---K-----
A0A3P9MKK4_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3B3I2Q5_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3P9I2N4_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3B3QRZ2_BCL2L1-      CVEKEMGHLVDR-----IADWMTVYLDSNIQPWIQR-QGGW---D-----
A0A3B3ZMX9_BCL2L1-      CVDKEMSTLVAR-----IVTWMTVYLDEHIQDWIDS-QGGW---A-----
G3NJY1_BCL2L1-01        CVDKEMSPLVGR-----IVEWMTLYLDNHIQPWIQN-QGGW---------
A0A2U9BY16_BCL2L1-      CVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW---E-----
A0A3Q3DUT7_BCL2L1-      CMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW---Q-----
A0A3Q3DUT7_BCL2L1-      CMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW---Q-----
A0A3Q3DUT7_BCL2L1-      CMEKEMIPLVDR-----IIEWMTVYLDNHLQPWIES-QGGW---Q-----
A0A3B1JJ42_BCL2L1-      CVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQE-QGGW---E-----
A0A3P8UWG7_BCL2L1-      CVEKEMSQLVAR-----IADWMTVYLDNHIQPWIET-QGGW---E-----
A0A3Q3IVF5_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQG-QGGW---E-----
A0A3Q1DHJ3_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---E-----
A0A3Q1DHJ3_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---E-----
A0A3Q1DHJ3_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---E-----
A0A3P8TL99_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---E-----
A0A3P8TL99_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---E-----
A0A3Q1FR00_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQG-QGGW---E-----
A0A3B4Z3X2_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---D-----
A0A3B4Z3X2_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQDWIQS-QGGW---D-----
C3VIT1_BCL2L1-01        CVEREMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3P8P0F1_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q2X557_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3P9D632_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3P9D632_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q4N4B5_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3B4FNX1_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q2QPL9_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDEQIDPWIQS-QGGW---E-----
A0A3B5PQJ0_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDEQIEPWVES-QGGW---E-----
A0A087X9B7_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW---D-----
A0A3B3TUS7_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW---D-----
A0A3B3WI27_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW---D-----
A0A3P9N9Y4_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDERIEPWVES-QGGW---E-----
A0A3Q3BEB7_BCL2L1-      CVERDMSELVSR-----IADWMTVYLDEQIGPWIDS-QGGW---D-----
A0A3P8VMA1_BCL2L1-      CVQRNMSELVPR-----IADWMTMYLDEYIDPWIQS-QGGW---D-----
A0A345BSW9_BCL2L1-      CVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW---------
A0A286MU87_BCL2L1-      CVEKDMSPLVAR-----IADWMTTYLDNHIQPWIQS-QGGW---------
A0A3P8XFS0_BCL2L1-      CVEKDMSLLVAR-----IADWMTTYLDEHIQPWIQI-QGGW---D-----
A0A3P8XFS0_BCL2L1-      CVEKDMSLLVAR-----IADWMTTYLDEHIQPWIQI-QGGW---D-----
A0A0F7L1T6_BCL2L1-      CVERDASQLVCR-----IADWMTIYLDEHINPWIQS-QGGW---D-----
H2U5I3_BCL2L1-01        CVEKDASQLVCR-----IADWMTIYLDEHINPWIQS-QGGW---D-----
A0A3Q3J5K3_BCL2L1-      CVEKNMSELVSR-----IADWMTMYLDEHISPWIQN-QGGW---D-----
A0A3Q1EVP6_BCL2L1-      CVEKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGDW---E-----
A0A3Q1BQA0_BCL2L1-      CVEKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGGW---E-----
A0A3P8U812_BCL2L1-      CVDKNMSELVPR-----IADWMTMYLDEHISPWIQS-QGGW---E-----
E6ZFR0_BCL2L1-01        CVEKDMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW---D-----
G3P7B4_BCL2L1-01        CVEKDMTELVSR-----IADWMTTYLDEHISAWIQS-QGGW---D-----
A0A3Q3X5M5_BCL2L1-      CAEKDTGELVCR-----IADWMTTYLDEHINPWIQS-QGGW---G-----
A0A2U9BIG9_BCL2L1-      CVEKNRGELVAR-----IADWMTMYLDEHISPWIQS-QGGW---G-----
A0A3B3E2W4_BCL2L1-      CVERNMSELVSR-----IAEWMTMYLDEQISPWIHS-QGGW---D-----
A0A3B3I2Q5_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3P9I2N4_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3P9MKK4_BCL2L1-      CVERNMGELVSR-----IAEWMTQYLDEQISPWIHS-HGGW---D-----
A0A3B5B4X7_BCL2L1-      CVDKNMNELVPR-----IADWMTMYLDEHISLWIQS-QGGW---E-----
A0A3B4BFZ8_BCL2L1-      CVEKDMSILVPR-----IANWMTIYLDENIATWIQN-QGGW---A-----
A0A3Q3FUB6_BCL2L1-      CVQKDMGELVSR-----IAGWMTTYLDEHISAWIES-QGGW---D-----
A0A3B5MGS2_BCL2L1-      CVQKNMSELVSR-----IAEWMTTYLDEQLSPWIQS-QGGW---D-----
M4A558_BCL2L1-01        CVQKNMSELVSR-----IAEWMTTYLDEQLSPWIQS-QGGW---D-----
A0A3P9QFB3_BCL2L1-      CVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW---D-----
A0A087YBW4_BCL2L1-      CVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW---D-----
A0A3B3VWI7_BCL2L1-      CVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW---D-----
A0A3B3XN57_BCL2L1-      CVQKNMSELVSR-----IAEWMTTYLDEQLNPWIQS-QGGW---D-----
A0A3Q2C6K4_BCL2L1-      CVQKNMSELVSR-----IADWMTIYLDEQLNPWIHS-QGGW---D-----
A0A3Q2NRP4_BCL2L1-      CVQKNMSELVPR-----IADWMTIYLDEQLDPWVRS-QGGW---E-----
A0A0B4KJI5_BCL2L1-      CVEKDTSELVSR-----IADWMTMYLDEHINPWIES-QGGW---D-----
A0A3Q1JZ46_BCL2L1-      CVEKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW---D-----
A0A3Q1JZ46_BCL2L1-      CVEKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW---D-----
A0A3Q3NFM4_BCL2L1-      CIEKNMSALVSR-----IADWMTMYLDEHISPWIES-QGGW---D-----
A0A3Q3NFM4_BCL2L1-      CIEKNMSALVSR-----IADWMTMYLDEHISPWIES-QGGW---D-----
A0A3B4V9K8_BCL2L1-      CIQKNMSELVSR-----ITDWMTMYLDEHISPWIQS-QGGW---D-----
A0A3B4XS24_BCL2L1-      CIQKNMSELVSR-----IADWMTMYLDEHISPWIQS-QGGW---D-----
A0A2U9BY16_BCL2L1-      CVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW---T-----
C1BLI0_BCL2L1-01        CVEKDMSHLVAR-----IADWMTTYLDNHIQPWIQR-QGGW---D-----
C0HAD8_BCL2L1-01        CVEKDMSPLVAR-----IADWMTTYLDNHIQPWIQS-QGGW---D-----
A0A3B3ZMX9_BCL2L1-      CVDKEMSTLVAR-----IVTWMTVYLDEHIQDWIDS-QGGW---A-----
A0A3B3TFR4_BCL2L1-      CVEKEMSPLVGH-----IVDWMTVYLDNHIQPWIQT-QGGW---D-----
H3CH49_BCL2L1-01        CVEKEMNPLVGR-----IIEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q2FR43_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDEQIDPWIQS-QGGW---E-----
A0A3P8XYL5_BCL2L1-      CVEKEMSPLVGR-----IADWMTVYLDNHIQPWIES-QGGW---D-----
Q90Z98_BCL2L1-02        CVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW---E-----
Q90Z98_BCL2L1-01        CVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A059PJI5_BCL2L1-      CVEKEMSPLVAR-----IAEWMTVYLDNHIQPWIEE-QGGW---E-----
A0A3B4DTL9_BCL2L1-      CVEKEMSPLVGR-----IAEWMTVYLDNHIQPWIQE-QGGW---E-----
B5XAY3_BCL2L1-01        CVDKEMNPLVGR-----ITDWMTVYLDNHIQPWIQS-QGGW---D-----
W5MG74_BCL2L1-01        CVEKEMSNLVSR-----IAEWMTVYLDNNIQPWIQS-QGGW---D-----
A0A3Q3B3X5_BCL2L1-      CVEKEMSHLVAR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3B3IB64_BCL2L1-      CVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3P9JYH1_BCL2L1-      CVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3B3DHA1_BCL2L1-      CVEKEMSPLVDR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q0RTF8_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
I3IZK7_BCL2L1-01        CVEKEMSPLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A2U9BY16_BCL2L1-      CVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW---E-----
A0A2U9BY16_BCL2L1-      CVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW---E-----
A0A2U9BY16_BCL2L1-      CVEKEMSSLVGR-----IVEWMTVYLDNNIQPWIQS-QGGW---E-----
A0A0D6DR75_BCL2L1-      CVEKEMSQLVVR-----IVEWMTVYLDDHIQPWIQS-QGGW---E-----
A0A3Q3WIW8_BCL2L1-      CVEKEMSPLVGR-----IIEWMTVYLDNQIQPWIES-QGGW---Q-----
A0A219P0Y3_BCL2L1-      CVEKEMSPLVGR-----IIEWKTRYLDNHIQPWIQS-QRGW---E-----
A0A3Q3MX20_BCL2L1-      CVEKEMSPLVGR-----IVEWMTLYLDNHIEPWIQS-QGGW---E-----
A0A3Q3G2E1_BCL2L1-      CVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW---E-----
A0A3Q3G2E1_BCL2L1-      CVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW---E-----
A0A3Q3G2E1_BCL2L1-      CVEKEMSPLVGR-----IIEWMTVYLDNRIQPWIES-QGGW---E-----
A0A3Q1GZ93_BCL2L1-      CVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q1GZ93_BCL2L1-      CVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3Q1GZ93_BCL2L1-      CVEKEMSQLVGR-----IVEWMTVYLDNHIQPWIQS-QGGW---E-----
A0A3B4V3T1_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNRIQPWIQS-QGGW---E-----
A0A3B4XU17_BCL2L1-      CVEKEMSPLVGR-----IVEWMTVYLDNRIQPWIQS-QGGW---E-----
H3ANS8_BCL2L1-01        SMDKEMSSLVER-----IAEWMTTYLDDNLNPWIQE-QGGW---A-----
A0A452FHY1_BCL2L1-      SVDKEMQVLVSQ-----VMTWMASQLNDHLEPWIQE-NGGW---D-----
A0A452FHY1_BCL2L1-      SVDKEMQVLVSQ-----VMTWMASQLNDHLEPWIQE-NGGW---D-----
A0A1S3EPX7_BCL2L1-      SVDKEMQVLVSR-----IASWMATYLNDHLEPWIQE-HGGW---D-----
A0A218USB3_BCL2L1-      SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
A0A218USB3_BCL2L1-      SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
U3JSL7_BCL2L1-01        SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
A0A218USB3_BCL2L1-      SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
A0A218USB3_BCL2L1-      SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
H0Z8G3_BCL2L1-01        SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
Q4U2V6_BCL2L1-01        SVVKEMRVLVKR-----IVSWMTTYLTDHLDPWIQE-NGGW---E-----
                                :                       *:     .*         

A0A3Q1FR00_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
R4JQR8_BCL2L1-01        G---FVE-----------------AYNQ----------------------
A0A346RRN1_BCL2L1-      G---FVE-----------------YYNQ----------------------
Q2TAP5_BCL2L1-01        A---FVG-----------------LYGK-----------NAAA-------
Q91828_BCL2L1-01        A---FVG-----------------LYGK-----------NAAA-------
I7GKS6_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A2K5EBP4_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5Q6R6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6UWY8_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5M8B1_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5H963_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5VPG2_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5YR37_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2R8Z9D7_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A096NV05_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6QFA2_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A1U7T4L4_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6G3C5_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A3Q1LRT3_BCL2L1-      T---FVE-----------------LYES-----------NTTN-------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        T-------------------------------------------------
A0A493TIA6_BCL2L1-      RGCSFCT-----------------PLGDLGWIWPLSALQITPP-------
Q07816_BCL2L1-02        R---FVD-----------------LYGN-----------NAAA-------
Q07816_BCL2L1-03        R---FVD-----------------LYGN-----------NAAA-------
Q07816_BCL2L1-01        R---FVD-----------------LYGN-----------NAAA-------
G1N5N5_BCL2L1-01        R---FVD-----------------LYGN-----------NAAA-------
A0A452ILL8_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
A0A452ILL8_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
K7F655_BCL2L1-01        R---FVD-----------------LYGN-----------DAAA-------
A0A452E1B1_BCL2L1-      I---FVE-----------------LYEN-----------NTAT-------
W5PSA5_BCL2L1-01        I---FVE-----------------LYEN-----------NTAT-------
P53563_BCL2L1-03        P---LVC-----------------LSSV-----------EIPNCPFWSPG
P53563_BCL2L1-02        P---LVC-----------------LSSV-----------EIPNCPFWSPG
A0A287CZ07_BCL2L1-      T---FVE-----------------LYRN-----------NAAA-------
F6WA14_BCL2L1-01        T---FVE-----------------LYGN-----------DAAA-------
G3WKX6_BCL2L1-01        T---FVE-----------------LYGN-----------DAAA-------
M3XA94_BCL2L1-01        R---LCA-----------------PQGA-----------HSPE-------
M3XA94_BCL2L1-02        T---FVE-----------------LYGN-----------NAAA-------
A0A3Q2H0F6_BCL2L1-      T---FCY-----------------FVSS-----------LMRL-------
H0X6V2_BCL2L1-01        A---FPE-----------------LLSP-----------KSNS-------
G3SPN0_BCL2L1-01        R---TTP-----------------LLCF-----------STSV-------
Q2PFS6_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
O35843_BCL2L1-01        V-------------------------------------------------
M3XA94_BCL2L1-03        W---TGL-----------------FYPE-----------FLAQ-------
G1RER8_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A1S2ZQT6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
Q64373_BCL2L1-09        T---FVD-----------------LYGN-----------NAAA-------
Q64373_BCL2L1-01        T---FVD-----------------LYGN-----------NAAA-------
P53563_BCL2L1-01        T---FVD-----------------LYGN-----------NAAA-------
O77737_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
Q9MYW4_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A3Q2H0F6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
L8J061_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
Q05KJ0_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
Q05KJ0_BCL2L1-02        T---FVE-----------------LYGN-----------NAAA-------
E2IV76_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A2K6G3C5_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
B2Z3Z4_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
G3HEA7_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
G3HEA7_BCL2L1-02        T---FVE-----------------LYGN-----------NAAA-------
A0A1U7T4L4_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
M3Z2H9_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A1U7QU73_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A0D9RJZ8_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A286Y5D6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A250YD48_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A1L5BWY3_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
I3MUP5_BCL2L1-02        T---FVE-----------------LYGN-----------NAAA-------
I3MUP5_BCL2L1-03        T---FVE-----------------LYGN-----------NAAA-------
I3MUP5_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
G1P9D2_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A2K5EBP4_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
E2IV75_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
F7IT34_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
Q76LT7_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A2K5Q6R6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5Q6R6_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5M8B1_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5H963_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
Q8SQ42_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A2K5VPG2_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K5YR37_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2R8Z9D7_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A096NV05_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2J8VIH3_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6QFA2_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6QFA2_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A2K6UWY8_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
E2IV77_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
A0A452SDS4_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A384D3U1_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A452FWV3_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
Q9MZS7_BCL2L1-01        T---FVE-----------------LYGN-----------NAAA-------
D2ITA2_BCL2L1-02        H---FAA-----------------VFGS-----------DAAA-------
A0A3P9MKK4_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3B3I2Q5_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3P9I2N4_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3B3QRZ2_BCL2L1-      R---FAE-----------------IFGK-----------DAAA-------
A0A3B3ZMX9_BCL2L1-      R---FAE-----------------IYGQ-----------DAAA-------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A3Q3DUT7_BCL2L1-      R---FAE-----------------IFGH-----------DAAA-------
A0A3Q3DUT7_BCL2L1-      R---FAE-----------------IFGH-----------DAAA-------
A0A3Q3DUT7_BCL2L1-      R---FAE-----------------IFGH-----------DAAA-------
A0A3B1JJ42_BCL2L1-      R---FAE-----------------IFGN-----------DTAA-------
A0A3P8UWG7_BCL2L1-      H---FAE-----------------LFGQ-----------DAAA-------
A0A3Q3IVF5_BCL2L1-      R---FAE-----------------LFGQ-----------DAAA-------
A0A3Q1DHJ3_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q1DHJ3_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q1DHJ3_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3P8TL99_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3P8TL99_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q1FR00_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3B4Z3X2_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3B4Z3X2_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
C3VIT1_BCL2L1-01        R---FAE-----------------IFGQ-----------DAAA-------
A0A3P8P0F1_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q2X557_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3P9D632_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3P9D632_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q4N4B5_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A3B4FNX1_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q2QPL9_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A3B5PQJ0_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A087X9B7_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A3B3TUS7_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A3B3WI27_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A3P9N9Y4_BCL2L1-      R---FAE-----------------IFGG-----------NAAA-------
A0A3Q3BEB7_BCL2L1-      S---FAE-----------------MYGR-----------DAAA-------
A0A3P8VMA1_BCL2L1-      R---FAE-----------------IFGT-----------DCIP-------
A0A345BSW9_BCL2L1-      ------------------------VSGK----------------------
A0A286MU87_BCL2L1-      -----AE-----------------IFGR-----------DAAA-------
A0A3P8XFS0_BCL2L1-      R---FAD-----------------IFGR-----------DAAA-------
A0A3P8XFS0_BCL2L1-      R---FAD-----------------IFGR-----------DAAA-------
A0A0F7L1T6_BCL2L1-      C---FAK-----------------IFGD-----------DAAA-------
H2U5I3_BCL2L1-01        C---FAK-----------------IFGD-----------DAAA-------
A0A3Q3J5K3_BCL2L1-      C---FAE-----------------IFGR-----------DNAA-------
A0A3Q1EVP6_BCL2L1-      C---FAE-----------------IFGQ-----------NAAA-------
A0A3Q1BQA0_BCL2L1-      C---FAE-----------------IFGQ-----------NAAA-------
A0A3P8U812_BCL2L1-      C---FAE-----------------IFGQ-----------NAAA-------
E6ZFR0_BCL2L1-01        C---FAE-----------------VFGR-----------DAAA-------
G3P7B4_BCL2L1-01        C---FAD-----------------IFGR-----------DGAA-------
A0A3Q3X5M5_BCL2L1-      C---FAE-----------------VFGH-----------NAAA-------
A0A2U9BIG9_BCL2L1-      C---FAE-----------------IFGQ-----------GAGA-------
A0A3B3E2W4_BCL2L1-      C---FAQ-----------------LYGQ-----------DGAA-------
A0A3B3I2Q5_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3P9I2N4_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3P9MKK4_BCL2L1-      C---FAR-----------------LYGQ-----------NGAA-------
A0A3B5B4X7_BCL2L1-      C---FAE-----------------IFGQ-----------DAAA-------
A0A3B4BFZ8_BCL2L1-      S---FAQ-----------------IFGQ-----------NAAG-------
A0A3Q3FUB6_BCL2L1-      C---FVE-----------------IFGR-----------GAVG-------
A0A3B5MGS2_BCL2L1-      R---FAN-----------------LYGQ-----------DAAA-------
M4A558_BCL2L1-01        R---FAN-----------------LYGQ-----------DAAA-------
A0A3P9QFB3_BCL2L1-      H---FAN-----------------LYGQ-----------DAAA-------
A0A087YBW4_BCL2L1-      R---FAN-----------------LYGQ-----------DAAA-------
A0A3B3VWI7_BCL2L1-      R---FAN-----------------LYGQ-----------DAAA-------
A0A3B3XN57_BCL2L1-      R---FAN-----------------LYGQ-----------DAAA-------
A0A3Q2C6K4_BCL2L1-      C---FAK-----------------LYGQ-----------DAAA-------
A0A3Q2NRP4_BCL2L1-      C---FAK-----------------LYGQ-----------DAAA-------
A0A0B4KJI5_BCL2L1-      S---FAE-----------------VFGR-----------DAAA-------
A0A3Q1JZ46_BCL2L1-      C---FAE-----------------IFGQ-----------DAAA-------
A0A3Q1JZ46_BCL2L1-      C---FAE-----------------IFGQ-----------DAAA-------
A0A3Q3NFM4_BCL2L1-      C---FAE-----------------IFGR-----------DAAA-------
A0A3Q3NFM4_BCL2L1-      C---FAE-----------------IFGR-----------DAAA-------
A0A3B4V9K8_BCL2L1-      C---FAE-----------------MFGQ-----------DAAA-------
A0A3B4XS24_BCL2L1-      C---FAE-----------------MFGQ-----------DAAA-------
A0A2U9BY16_BCL2L1-      F---CHQTTRPVKPRKMKMPPRTVFHSA-----------DGSC-------
C1BLI0_BCL2L1-01        R---FAD-----------------IFGR-----------DAAA-------
C0HAD8_BCL2L1-01        R---FAE-----------------IFGR-----------DAAA-------
A0A3B3ZMX9_BCL2L1-      R---FAE-----------------IYGQ-----------DAAA-------
A0A3B3TFR4_BCL2L1-      R---FAE-----------------IFGN-----------DAAA-------
H3CH49_BCL2L1-01        R---FAE-----------------LFGQ-----------DAAA-------
A0A3Q2FR43_BCL2L1-      R---FAE-----------------IFGG-----------DAAA-------
A0A3P8XYL5_BCL2L1-      R---FAE-----------------IFGK-----------DAAA-------
Q90Z98_BCL2L1-02        R---FAE-----------------IFGK-----------DAAA-------
Q90Z98_BCL2L1-01        R---FAE-----------------IFGK-----------DAAA-------
A0A059PJI5_BCL2L1-      R---FAE-----------------IFGK-----------DAAA-------
A0A3B4DTL9_BCL2L1-      R---FAE-----------------IFGK-----------DAAA-------
B5XAY3_BCL2L1-01        R---FAE-----------------IFGM-----------DAAA-------
W5MG74_BCL2L1-01        R---FAE-----------------IFGK-----------DAAA-------
A0A3Q3B3X5_BCL2L1-      R---FAE-----------------IFGD-----------NAAA-------
A0A3B3IB64_BCL2L1-      R---FAE-----------------IFGQ-----------EAAA-------
A0A3P9JYH1_BCL2L1-      R---FAE-----------------IFGQ-----------EAAA-------
A0A3B3DHA1_BCL2L1-      R---FAE-----------------IFGQ-----------EAAA-------
A0A3Q0RTF8_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
I3IZK7_BCL2L1-01        R---FAE-----------------IFGQ-----------DAAA-------
A0A2U9BY16_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A2U9BY16_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A2U9BY16_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A0D6DR75_BCL2L1-      H---FAE-----------------IFGH-----------DAAA-------
A0A3Q3WIW8_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A219P0Y3_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3Q3MX20_BCL2L1-      H---FAE-----------------IFGQ-----------DAAA-------
A0A3Q3G2E1_BCL2L1-      R---FSE-----------------IFGQ-----------DAAG-------
A0A3Q3G2E1_BCL2L1-      R---FSE-----------------IFGQ-----------DAAG-------
A0A3Q3G2E1_BCL2L1-      R---FSE-----------------IFGQ-----------DAAG-------
A0A3Q1GZ93_BCL2L1-      R---FAE-----------------LFGH-----------DAAA-------
A0A3Q1GZ93_BCL2L1-      R---FAE-----------------LFGH-----------DAAA-------
A0A3Q1GZ93_BCL2L1-      R---FAE-----------------LFGH-----------DAAA-------
A0A3B4V3T1_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
A0A3B4XU17_BCL2L1-      R---FAE-----------------IFGQ-----------DAAA-------
H3ANS8_BCL2L1-01        T---IIH-----------------IDGV-----------DAMQ-------
A0A452FHY1_BCL2L1-      T---SVE-----------------FCEN-----------NTAT-------
A0A452FHY1_BCL2L1-      T---SVE-----------------FCEN-----------NTAT-------
A0A1S3EPX7_BCL2L1-      T---FVE-----------------LYGN-----------NAAA-------
A0A218USB3_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
A0A218USB3_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
U3JSL7_BCL2L1-01        R---FVD-----------------LYGN-----------DAAA-------
A0A218USB3_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
A0A218USB3_BCL2L1-      R---FVD-----------------LYGN-----------DAAA-------
H0Z8G3_BCL2L1-01        R---FVD-----------------LYGN-----------DAAA-------
Q4U2V6_BCL2L1-01        R---FVD-----------------LYGN-----------DAAA-------
                                                                          

A0A3Q1FR00_BCL2L1-      ------ESRRSQES------FK-K--------------------------
R4JQR8_BCL2L1-01        ------GQNHNDSP------------------------------------
A0A346RRN1_BCL2L1-      ------AQNHNDNQ------------------------------------
Q2TAP5_BCL2L1-01        ------QSRESQER------FG-R--------------------------
Q91828_BCL2L1-01        ------QSRESQER------FG-R--------------------------
I7GKS6_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A2K5EBP4_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5Q6R6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6UWY8_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5M8B1_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5H963_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5VPG2_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5YR37_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2R8Z9D7_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A096NV05_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6QFA2_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A1U7T4L4_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6G3C5_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A3Q1LRT3_BCL2L1-      ------ESQKGQER------FN-C--------------------------
H9GHK7_BCL2L1-01        ------KSKGGQ--------------------------------------
Q07816_BCL2L1-04        ------STTQLPST------IT----------------------------
A0A493TIA6_BCL2L1-      ------PRPPPPRT------PP-R--------------------------
Q07816_BCL2L1-02        ------ELRKGQET------FN-K--------------------------
Q07816_BCL2L1-03        ------ELRKGQET------FN-K--------------------------
Q07816_BCL2L1-01        ------ELRKGQET------FN-K--------------------------
G1N5N5_BCL2L1-01        ------ELRKGQET------FN-K--------------------------
A0A452ILL8_BCL2L1-      ------KSRKGQEQ------FN-R--------------------------
A0A452ILL8_BCL2L1-      ------KSRKGQEQ------FN-R--------------------------
K7F655_BCL2L1-01        ------KSRKGQEQ------FN-R--------------------------
A0A452E1B1_BCL2L1-      ------ESQKGQEH------FN-R--------------------------
W5PSA5_BCL2L1-01        ------ESQKGQEH------LN-R--------------------------
P53563_BCL2L1-03        MVVEDIDYSGDIPG------FT-L--------------------------
P53563_BCL2L1-02        MVVEDIDYSGDIPG------FT-L--------------------------
A0A287CZ07_BCL2L1-      ------ESRKGQER------FN-R--------------------------
F6WA14_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
G3WKX6_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
M3XA94_BCL2L1-01        ------QSSP----------------------------------------
M3XA94_BCL2L1-02        ------ESRKGQVR------TNAETELPQRVCPVLGTTPCLDFAGTGRDC
A0A3Q2H0F6_BCL2L1-      ------SGQGGALQ------LA-P--------------------------
H0X6V2_BCL2L1-01        -----------------------I--------------------------
G3SPN0_BCL2L1-01        ------KEDIAYVF------IQVK--------------------------
Q2PFS6_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
O35843_BCL2L1-01        ---------SGGTP------LR-S--------------------------
M3XA94_BCL2L1-03        ------GLRLGK--------------------------------------
G1RER8_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A1S2ZQT6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
Q64373_BCL2L1-09        ------ESRKGQER------FN-R--------------------------
Q64373_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
P53563_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
O77737_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
Q9MYW4_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A3Q2H0F6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
L8J061_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
Q05KJ0_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
Q05KJ0_BCL2L1-02        ------ESRKGQER------FN-R--------------------------
E2IV76_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A2K6G3C5_BCL2L1-      ------ESRKGQER------FN-R--------------------------
B2Z3Z4_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
G3HEA7_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
G3HEA7_BCL2L1-02        ------ESRKGQER------FN-R--------------------------
A0A1U7T4L4_BCL2L1-      ------ESRKGQER------FN-R--------------------------
M3Z2H9_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A1U7QU73_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A0D9RJZ8_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A286Y5D6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A250YD48_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A1L5BWY3_BCL2L1-      ------ESRKGQER------FN-R--------------------------
I3MUP5_BCL2L1-02        ------ESRKGQER------FN-R--------------------------
I3MUP5_BCL2L1-03        ------ESRKGQER------FN-R--------------------------
I3MUP5_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
G1P9D2_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A2K5EBP4_BCL2L1-      ------ESRKGQER------FN-R--------------------------
E2IV75_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
F7IT34_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
Q76LT7_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A2K5Q6R6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5Q6R6_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5M8B1_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5H963_BCL2L1-      ------ESRKGQER------FN-R--------------------------
Q8SQ42_BCL2L1-01        ------ESRKGQER------SN-R--------------------------
A0A2K5VPG2_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K5YR37_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2R8Z9D7_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A096NV05_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2J8VIH3_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6QFA2_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6QFA2_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A2K6UWY8_BCL2L1-      ------ESRKGQER------FN-R--------------------------
E2IV77_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
A0A452SDS4_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A384D3U1_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A452FWV3_BCL2L1-      ------ESRKGQER------FN-R--------------------------
Q9MZS7_BCL2L1-01        ------ESRKGQER------FN-R--------------------------
D2ITA2_BCL2L1-02        ------GARRTRDS------HR-R--------------------------
A0A3P9MKK4_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3B3I2Q5_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3P9I2N4_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3B3QRZ2_BCL2L1-      ------ESRRSQEN------FK-K--------------------------
A0A3B3ZMX9_BCL2L1-      ------QSRHSEER------FK-K--------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      ------GSRRSQES------FK-K--------------------------
A0A3Q3DUT7_BCL2L1-      ------EVRRSQES------FK-K--------------------------
A0A3Q3DUT7_BCL2L1-      ------EVRRSQES------FK-K--------------------------
A0A3Q3DUT7_BCL2L1-      ------EVRRSQES------FK-K--------------------------
A0A3B1JJ42_BCL2L1-      ------ESRRMQER------YK-M--------------------------
A0A3P8UWG7_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q3IVF5_BCL2L1-      ------ENRRSQES------FK-K--------------------------
A0A3Q1DHJ3_BCL2L1-      ------ESRKSQES------FK-K--------------------------
A0A3Q1DHJ3_BCL2L1-      ------ESRKSQES------FK-K--------------------------
A0A3Q1DHJ3_BCL2L1-      ------ESRKSQES------FK-K--------------------------
A0A3P8TL99_BCL2L1-      ------ESRKSQES------FK-K--------------------------
A0A3P8TL99_BCL2L1-      ------ESRKSQES------FK-K--------------------------
A0A3Q1FR00_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3B4Z3X2_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3B4Z3X2_BCL2L1-      ------ESRRSQES------FK-K--------------------------
C3VIT1_BCL2L1-01        ------ESRRSQES------FK-K--------------------------
A0A3P8P0F1_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q2X557_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3P9D632_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3P9D632_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q4N4B5_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3B4FNX1_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q2QPL9_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A3B5PQJ0_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A087X9B7_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A3B3TUS7_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A3B3WI27_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A3P9N9Y4_BCL2L1-      ------ESRRSQES------FK-N--------------------------
A0A3Q3BEB7_BCL2L1-      ------EARRFQES------LK-K--------------------------
A0A3P8VMA1_BCL2L1-      ------RTRSCRDT------VR-R--------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      ------DVRRSQES------II-K--------------------------
A0A3P8XFS0_BCL2L1-      ------DIRRSQES------LR-K--------------------------
A0A3P8XFS0_BCL2L1-      ------DIRRSQES------LR-K--------------------------
A0A0F7L1T6_BCL2L1-      ------EGRRAREN------LS-R--------------------------
H2U5I3_BCL2L1-01        ------EGRRAREN------LS-R--------------------------
A0A3Q3J5K3_BCL2L1-      ------EVRRSQET------LR-R--------------------------
A0A3Q1EVP6_BCL2L1-      ------EARRSRDT------LK-R--------------------------
A0A3Q1BQA0_BCL2L1-      ------EARRSRDT------LK-R--------------------------
A0A3P8U812_BCL2L1-      ------EARRSRDT------LK-R--------------------------
E6ZFR0_BCL2L1-01        ------EARRSRET------LS-R--------------------------
G3P7B4_BCL2L1-01        ------AARRSQET------MR-R--------------------------
A0A3Q3X5M5_BCL2L1-      ------EARRSQET------LN-R--------------------------
A0A2U9BIG9_BCL2L1-      ------EARRYRES------VR-R--------------------------
A0A3B3E2W4_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3B3I2Q5_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3P9I2N4_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3P9MKK4_BCL2L1-      ------EARRFQET------LK-K--------------------------
A0A3B5B4X7_BCL2L1-      ------EARRSRDS------LK-R--------------------------
A0A3B4BFZ8_BCL2L1-      ------EARRSRET------LK-K--------------------------
A0A3Q3FUB6_BCL2L1-      ------EVRRSRET------LT-R--------------------------
A0A3B5MGS2_BCL2L1-      ------EGRRFRET------LN-K--------------------------
M4A558_BCL2L1-01        ------EGRRFRET------LN-K--------------------------
A0A3P9QFB3_BCL2L1-      ------EGRRFRET------LN-K--------------------------
A0A087YBW4_BCL2L1-      ------EGRRFRET------LN-K--------------------------
A0A3B3VWI7_BCL2L1-      ------EGRRFRET------LN-K--------------------------
A0A3B3XN57_BCL2L1-      ------EGRRFRET------LN-K--------------------------
A0A3Q2C6K4_BCL2L1-      ------EGRRSHET------LN-K--------------------------
A0A3Q2NRP4_BCL2L1-      ------AGRRFQET------LN-K--------------------------
A0A0B4KJI5_BCL2L1-      ------EARRSRET------LS-R--------------------------
A0A3Q1JZ46_BCL2L1-      ------EARRSREA------LR-R--------------------------
A0A3Q1JZ46_BCL2L1-      ------EARRSREA------LR-R--------------------------
A0A3Q3NFM4_BCL2L1-      ------EARRSQET------LR-R--------------------------
A0A3Q3NFM4_BCL2L1-      ------EARRSQET------LR-R--------------------------
A0A3B4V9K8_BCL2L1-      ------EARRSREA------VM-K--------------------------
A0A3B4XS24_BCL2L1-      ------EARRSREA------VR-R--------------------------
A0A2U9BY16_BCL2L1-      ------ISGKVWQN------LS-R--------------------------
C1BLI0_BCL2L1-01        ------EVRRSQEN------LR-R--------------------------
C0HAD8_BCL2L1-01        ------DVRRSQES------II-K--------------------------
A0A3B3ZMX9_BCL2L1-      ------QSRHSEER------FK-K--------------------------
A0A3B3TFR4_BCL2L1-      ------EGRRSRER------FQ-Q--------------------------
H3CH49_BCL2L1-01        ------ESRRSQER------FR-N--------------------------
A0A3Q2FR43_BCL2L1-      ------ESRRSQES------LK-N--------------------------
A0A3P8XYL5_BCL2L1-      ------NSRKSQES------FK-K--------------------------
Q90Z98_BCL2L1-02        ------ESRKSQES------FK-K--------------------------
Q90Z98_BCL2L1-01        ------ESRKSQES------FK-K--------------------------
A0A059PJI5_BCL2L1-      ------EGRRSQES------FK-K--------------------------
A0A3B4DTL9_BCL2L1-      ------ESRRSQEN------FK-K--------------------------
B5XAY3_BCL2L1-01        ------ESRKSQES------FK-K--------------------------
W5MG74_BCL2L1-01        ------EYRRSQES------FK-K--------------------------
A0A3Q3B3X5_BCL2L1-      ------ESRISQEG------LK-K--------------------------
A0A3B3IB64_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3P9JYH1_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3B3DHA1_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q0RTF8_BCL2L1-      ------ESRRSQES------FK-K--------------------------
I3IZK7_BCL2L1-01        ------ESRRSQES------FK-K--------------------------
A0A2U9BY16_BCL2L1-      ------GSRRSQES------FK-K--------------------------
A0A2U9BY16_BCL2L1-      ------GSRRSQES------FK-K--------------------------
A0A2U9BY16_BCL2L1-      ------GSRRSQES------FK-K--------------------------
A0A0D6DR75_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q3WIW8_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A219P0Y3_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3Q3MX20_BCL2L1-      ------ESRRSQEN------FK-K--------------------------
A0A3Q3G2E1_BCL2L1-      ------EIRRSQES------FK-K--------------------------
A0A3Q3G2E1_BCL2L1-      ------EIRRSQES------FK-K--------------------------
A0A3Q3G2E1_BCL2L1-      ------EIRRSQES------FK-K--------------------------
A0A3Q1GZ93_BCL2L1-      ------EGRRSQES------FK-K--------------------------
A0A3Q1GZ93_BCL2L1-      ------EGRRSQES------FK-K--------------------------
A0A3Q1GZ93_BCL2L1-      ------EGRRSQES------FK-K--------------------------
A0A3B4V3T1_BCL2L1-      ------ESRRSQES------FK-K--------------------------
A0A3B4XU17_BCL2L1-      ------DSRRSQES------FK-K--------------------------
H3ANS8_BCL2L1-01        ------RSNTRSEKLGFVGFFF-S--------------------------
A0A452FHY1_BCL2L1-      ------ESQKGQER------FN-C--------------------------
A0A452FHY1_BCL2L1-      ------ESQKGQER------FN-C--------------------------
A0A1S3EPX7_BCL2L1-      ------ESRKGQER------FN-R--------------------------
A0A218USB3_BCL2L1-      ------EMRKGQET------FN-K--------------------------
A0A218USB3_BCL2L1-      ------EMRKGQET------FN-K--------------------------
U3JSL7_BCL2L1-01        ------EVRKGQET------FN-K--------------------------
A0A218USB3_BCL2L1-      ------EMRKGQET------FN-K--------------------------
A0A218USB3_BCL2L1-      ------EMRKGQET------FN-K--------------------------
H0Z8G3_BCL2L1-01        ------EMRKGQET------FN-K--------------------------
Q4U2V6_BCL2L1-01        ------EMRKGQET------FN-K--------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
R4JQR8_BCL2L1-01        WD-------VKG-------------------LVKYGAIGVIGA---MALS
A0A346RRN1_BCL2L1-      WN-------LGE-------------------FVRYGAIGVVGA---LALG
Q2TAP5_BCL2L1-01        ---------LLT-------------------------IVILTG---VFAL
Q91828_BCL2L1-01        ---------LLT-------------------------IVMLTG---VFAL
I7GKS6_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5EBP4_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5Q6R6_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6UWY8_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5M8B1_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5H963_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5VPG2_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5YR37_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2R8Z9D7_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A096NV05_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6QFA2_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A1U7T4L4_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6G3C5_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A3Q1LRT3_BCL2L1-      WSL------TTR-------------------------LWLFGI---FLIK
H9GHK7_BCL2L1-01        ---------IIS-------------------------VIYTHHSEVCLNT
Q07816_BCL2L1-04        ---------ITG-------------------------RSPRST---ELPS
A0A493TIA6_BCL2L1-      PL-------PLP-------------------------PSLPPS---LPPG
Q07816_BCL2L1-02        WL-------LTG-------------------------ATVAGV---LLLG
Q07816_BCL2L1-03        WL-------LTG-------------------------ATVAGV---LLLG
Q07816_BCL2L1-01        WL-------LTG-------------------------ATVAGV---LLLG
G1N5N5_BCL2L1-01        WL-------LTG-------------------------ATVAGV---LLLG
A0A452ILL8_BCL2L1-      WL-------LTG-------------------------ATLAGV---LLLG
A0A452ILL8_BCL2L1-      WL-------LTG-------------------------ATLAGV---LLLG
K7F655_BCL2L1-01        GL-------LTG-------------------------ATVAGV---LLLG
A0A452E1B1_BCL2L1-      WS-------LTD-------------------------VTVAGM---ALLG
W5PSA5_BCL2L1-01        WS-------LTD-------------------------MTVAGM---ALLG
P53563_BCL2L1-03        ---------IPG-------------------------VNFGNIDDPVFKE
P53563_BCL2L1-02        ---------IPG-------------------------VNFGNIDDPVFKE
A0A287CZ07_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
F6WA14_BCL2L1-01        WL-------LTG-------------------------MTVAGV---VLLG
G3WKX6_BCL2L1-01        WL-------LTG-------------------------MTVAGV---VLLG
M3XA94_BCL2L1-01        WSTSSRERRHDG-------------------------QGNKQD---CSGD
M3XA94_BCL2L1-02        WPGRWRKPPLGG-------------------------SDHSAQ---LPSQ
A0A3Q2H0F6_BCL2L1-      SYSAFWADSRAP-------------------------LGTRGF---SLAL
H0X6V2_BCL2L1-01        YFKVCMCGNFCS-------------------------LAAAGR---CLTI
G3SPN0_BCL2L1-01        TY-------ASG-------------------------KLVQCF---LTLT
Q2PFS6_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
O35843_BCL2L1-01        VF-------RRL-------------------------VQVPGVAEHVCDP
M3XA94_BCL2L1-03        -----------G-------------------------LASICS---MNMR
G1RER8_BCL2L1-01        WF-------LTG--------------------------------------
A0A1S2ZQT6_BCL2L1-      WF-------LTG-------------------------VTVAGL---VMLG
Q64373_BCL2L1-09        WF-------LTG-------------------------MTVAGV---VLLG
Q64373_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
P53563_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
O77737_BCL2L1-01        WF-------LTG-------------------------MTLAGV---VLLG
Q9MYW4_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A3Q2H0F6_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
L8J061_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
Q05KJ0_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
Q05KJ0_BCL2L1-02        WF-------LTG-------------------------MTVAGV---VLLG
E2IV76_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6G3C5_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
B2Z3Z4_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
G3HEA7_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
G3HEA7_BCL2L1-02        WF-------LTG-------------------------MTVAGV---VLLG
A0A1U7T4L4_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
M3Z2H9_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A1U7QU73_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A0D9RJZ8_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A286Y5D6_BCL2L1-      WL-------LTG-------------------------VTVAGV---VLLG
A0A250YD48_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A1L5BWY3_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
I3MUP5_BCL2L1-02        WF-------LTG-------------------------MTVAGV---VLLG
I3MUP5_BCL2L1-03        WF-------LTG-------------------------MTVAGV---VLLG
I3MUP5_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
G1P9D2_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5EBP4_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
E2IV75_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
F7IT34_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
Q76LT7_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5Q6R6_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5Q6R6_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5M8B1_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5H963_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
Q8SQ42_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5VPG2_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K5YR37_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2R8Z9D7_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A096NV05_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2J8VIH3_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6QFA2_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6QFA2_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A2K6UWY8_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
E2IV77_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
A0A452SDS4_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A384D3U1_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A452FWV3_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
Q9MZS7_BCL2L1-01        WF-------LTG-------------------------MTVAGV---VLLG
D2ITA2_BCL2L1-02        WM-------LVG-------------------------AALLTG---VLLG
A0A3P9MKK4_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3B3I2Q5_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3P9I2N4_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3B3QRZ2_BCL2L1-      WL-------LAG-------------------------MTLITG---VVVG
A0A3B3ZMX9_BCL2L1-      WL-------FAG-------------------------MTLVTG---VVVG
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3DUT7_BCL2L1-      WL-------LAG-------------------------VTLVTG---VVVG
A0A3Q3DUT7_BCL2L1-      WL-------LAG-------------------------VTLVTG---VVVG
A0A3Q3DUT7_BCL2L1-      WL-------LAG-------------------------VTLVTG---VVVG
A0A3B1JJ42_BCL2L1-      WL-------LVG-------------------------MTLFTG---IVVG
A0A3P8UWG7_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3IVF5_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q1DHJ3_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3Q1DHJ3_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3Q1DHJ3_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3P8TL99_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3P8TL99_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3Q1FR00_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3B4Z3X2_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
A0A3B4Z3X2_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVVG
C3VIT1_BCL2L1-01        WL-------LVG-------------------------MTVVTG---VVVG
A0A3P8P0F1_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3Q2X557_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3P9D632_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3P9D632_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3Q4N4B5_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3B4FNX1_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
A0A3Q2QPL9_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A3B5PQJ0_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A087X9B7_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A3B3TUS7_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A3B3WI27_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A3P9N9Y4_BCL2L1-      WL-------LLG-------------------------MSVVTA---FIAG
A0A3Q3BEB7_BCL2L1-      WL-------LAG-------------------------AALLAG---LLLG
A0A3P8VMA1_BCL2L1-      WL-------LVG-------------------------AGLLAA---VLIG
A0A345BSW9_BCL2L1-      -------------------------------------LLAFLS---YLVP
A0A286MU87_BCL2L1-      WL-------LVG-------------------------VILLSG---VLVG
A0A3P8XFS0_BCL2L1-      WL-------LFG--------------------------------------
A0A3P8XFS0_BCL2L1-      WL-------LFG-------------------------VMLLSG---VLVG
A0A0F7L1T6_BCL2L1-      WM-------LGG-------------------------LALLMG---VLVG
H2U5I3_BCL2L1-01        WM-------LGG-------------------------LALLMG---VLVG
A0A3Q3J5K3_BCL2L1-      WL-------LVG-------------------------VVLLTG---VLVG
A0A3Q1EVP6_BCL2L1-      WL-------LAG-------------------------GVLLMG---VLAG
A0A3Q1BQA0_BCL2L1-      WL-------LVG-------------------------GVLLMG---VLAG
A0A3P8U812_BCL2L1-      WL-------LVG-------------------------GVLLMG---VLAG
E6ZFR0_BCL2L1-01        WL-------LIG-------------------------VALLMG---AVVG
G3P7B4_BCL2L1-01        WL-------LVG-------------------------VALLMG---VLVG
A0A3Q3X5M5_BCL2L1-      WL-------LVG-------------------------VALLMG---VMVG
A0A2U9BIG9_BCL2L1-      WL-------LVG-------------------------VGMLTG---VLIA
A0A3B3E2W4_BCL2L1-      WT-------LVA-------------------------VALLTG---LLLG
A0A3B3I2Q5_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3P9I2N4_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3P9MKK4_BCL2L1-      WM-------LVT-------------------------VALLTG---LLLG
A0A3B5B4X7_BCL2L1-      WL-------LVG-------------------------GALLTG---VLAG
A0A3B4BFZ8_BCL2L1-      WL-------LVG-------------------------VGLLAG---VLVA
A0A3Q3FUB6_BCL2L1-      WL-------LVG-------------------------MALLMG---VVVG
A0A3B5MGS2_BCL2L1-      WL-------LVG-------------------------VALLTG---ALLV
M4A558_BCL2L1-01        WL-------LVG-------------------------VALLTG---ALLV
A0A3P9QFB3_BCL2L1-      WL-------LVG-------------------------VALLTG---ALLV
A0A087YBW4_BCL2L1-      WL-------LVG-------------------------VALLTG---ALLV
A0A3B3VWI7_BCL2L1-      WL-------LVG-------------------------VALLTG---ALLV
A0A3B3XN57_BCL2L1-      WL-------LVG-------------------------VALLTG---ALLV
A0A3Q2C6K4_BCL2L1-      WL-------LVG-------------------------AALLGG---VLLT
A0A3Q2NRP4_BCL2L1-      WL-------LVG-------------------------AALLTG---FLLV
A0A0B4KJI5_BCL2L1-      WL-------LVG-------------------------VALLMG---VVLG
A0A3Q1JZ46_BCL2L1-      WL-------LVG-------------------------VVLLTG---VLLG
A0A3Q1JZ46_BCL2L1-      WL-------LVG-------------------------VVLLTG---VLLG
A0A3Q3NFM4_BCL2L1-      WL-------LVG-------------------------VALLTG---VLIG
A0A3Q3NFM4_BCL2L1-      WL-------LVG-------------------------VALLTG---VLIG
A0A3B4V9K8_BCL2L1-      WL-------LVG-------------------------VAMLAG---VLMG
A0A3B4XS24_BCL2L1-      WL-------LVG-------------------------VAMLAG---VLMG
A0A2U9BY16_BCL2L1-      YT-------AAGQRGEKQEGVQCHGCNRLTHPPPLSVVCVVAG---SLSL
C1BLI0_BCL2L1-01        WL-------LVG-------------------------AILLAG---VLVG
C0HAD8_BCL2L1-01        WL-------LVG-------------------------VILLSG---VLVG
A0A3B3ZMX9_BCL2L1-      WL-------FAG-------------------------MTLVTG---VVVG
A0A3B3TFR4_BCL2L1-      WL-------PAA-------------------------MALVAG---ALVG
H3CH49_BCL2L1-01        GL-------FLG-------------------------MSLAAG---IALG
A0A3Q2FR43_BCL2L1-      WL-------LLG-------------------------MSVATA---LIAG
A0A3P8XYL5_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
Q90Z98_BCL2L1-02        WL-------FAG-------------------------MTLLTG---VVVG
Q90Z98_BCL2L1-01        WL-------FAG-------------------------MTLLTG---VVVG
A0A059PJI5_BCL2L1-      WL-------LAG-------------------------VTLFTG---VVVG
A0A3B4DTL9_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
B5XAY3_BCL2L1-01        WL-------LAG-------------------------MTLVTG---VVVG
W5MG74_BCL2L1-01        WL-------LAG-------------------------MTLVTG---LVVG
A0A3Q3B3X5_BCL2L1-      WL-------LVG-------------------------MTVVTA---VVAG
A0A3B3IB64_BCL2L1-      WL-------LVG-------------------------MTVATG---VLVG
A0A3P9JYH1_BCL2L1-      WL-------LVG-------------------------MTVATG---VLVG
A0A3B3DHA1_BCL2L1-      WL-------LVG-------------------------MTVATG---VLVG
A0A3Q0RTF8_BCL2L1-      WL-------LVG-------------------------MTVVTG---VVAG
I3IZK7_BCL2L1-01        WL-------LVG-------------------------MTVVTG---VVAG
A0A2U9BY16_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A2U9BY16_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A2U9BY16_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A0D6DR75_BCL2L1-      WL-------LAG-------------------------MTVVTG---VVAG
A0A3Q3WIW8_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A219P0Y3_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3MX20_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3G2E1_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3G2E1_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q3G2E1_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q1GZ93_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q1GZ93_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3Q1GZ93_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3B4V3T1_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
A0A3B4XU17_BCL2L1-      WL-------LAG-------------------------MTLVTG---VVVG
H3ANS8_BCL2L1-01        FL-------LRG-------------------------VERNLK---LFLR
A0A452FHY1_BCL2L1-      WS-------LTA-------------------------VTLAGG---SGLS
A0A452FHY1_BCL2L1-      WS-------LTA-------------------------VTLA------GLA
A0A1S3EPX7_BCL2L1-      WF-------LTG-------------------------MTVAGV---VLLG
A0A218USB3_BCL2L1-      WL-------LTG-------------------------ATVAGV---LLLS
A0A218USB3_BCL2L1-      WL-------LTG-------------------------ATVAGV---LLLS
U3JSL7_BCL2L1-01        WL-------LTG-------------------------ATVAGV---LLLG
A0A218USB3_BCL2L1-      WL-------LTG-------------------------ATVAGV---LLLG
A0A218USB3_BCL2L1-      WL-------LTG-------------------------ATVAGV---LLLG
H0Z8G3_BCL2L1-01        WL-------LTG-------------------------ATVAGV---LLLG
Q4U2V6_BCL2L1-01        WL-------LTG-------------------------ATVAGV---LLLG
                                                                          

A0A3Q1FR00_BCL2L1-      SLI-----------------AQKRL-------------------------
R4JQR8_BCL2L1-01        AFL-----------------HRT---------------------------
A0A346RRN1_BCL2L1-      ALL-----------------QRV---------------------------
Q2TAP5_BCL2L1-01        VCY-----------------MRRR--------------------------
Q91828_BCL2L1-01        VCY-----------------MRRR--------------------------
I7GKS6_BCL2L1-01        SLF-----------------SRK---------------------------
A0A2K5EBP4_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5Q6R6_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6UWY8_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5M8B1_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5H963_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5VPG2_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5YR37_BCL2L1-      SLF-----------------SRK---------------------------
A0A2R8Z9D7_BCL2L1-      SLF-----------------SRK---------------------------
A0A096NV05_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6QFA2_BCL2L1-      SLF-----------------SRK---------------------------
A0A1U7T4L4_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6G3C5_BCL2L1-      SLF-----------------SRK---------------------------
A0A3Q1LRT3_BCL2L1-      HIF-----------------TKQPSNCTLEHLSGRYATLL----------
H9GHK7_BCL2L1-01        YID-----------------------------------------------
Q07816_BCL2L1-04        --------------------SRRQLLLS----------------------
A0A493TIA6_BCL2L1-      LGF-----------------------------------------------
Q07816_BCL2L1-02        SLL-----------------SRK---------------------------
Q07816_BCL2L1-03        SLL-----------------SRK---------------------------
Q07816_BCL2L1-01        SLL-----------------SRK---------------------------
G1N5N5_BCL2L1-01        SLL-----------------SRK---------------------------
A0A452ILL8_BCL2L1-      SLL-----------------SRK---------------------------
A0A452ILL8_BCL2L1-      SLL-----------------SRK---------------------------
K7F655_BCL2L1-01        SLL-----------------SRK---------------------------
A0A452E1B1_BCL2L1-      LLF-----------------NT----------------------------
W5PSA5_BCL2L1-01        LLF-----------------NCK---------------------------
P53563_BCL2L1-03        PVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT---------------
P53563_BCL2L1-02        PVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT---------------
A0A287CZ07_BCL2L1-      SLF-----------------SRK---------------------------
F6WA14_BCL2L1-01        SLF-----------------SRK---------------------------
G3WKX6_BCL2L1-01        SLF-----------------SRK---------------------------
M3XA94_BCL2L1-01        KLF-----------------CNQLPQNLS---------------------
M3XA94_BCL2L1-02        GRS-----------------SRRRGRC-----------------------
A0A3Q2H0F6_BCL2L1-      QEM-----------------PLQ---------------------------
H0X6V2_BCL2L1-01        GVM-----------------GYS---------------------------
G3SPN0_BCL2L1-01        QWF-----------------TTQ---------------------------
Q2PFS6_BCL2L1-01        SLF-----------------SRK---------------------------
O35843_BCL2L1-01        SLW-----------------EVETEGSEVQGPPQLL--------------
M3XA94_BCL2L1-03        LLL-----------------DAG---------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      SLF-----------------SRK---------------------------
Q64373_BCL2L1-09        SLF-----------------SRK---------------------------
Q64373_BCL2L1-01        SLF-----------------SRK---------------------------
P53563_BCL2L1-01        SLF-----------------SRK---------------------------
O77737_BCL2L1-01        SLF-----------------SRK---------------------------
Q9MYW4_BCL2L1-01        SLF-----------------SRK---------------------------
A0A3Q2H0F6_BCL2L1-      SLF-----------------SRK---------------------------
L8J061_BCL2L1-01        SLF-----------------SRK---------------------------
Q05KJ0_BCL2L1-01        SLF-----------------SRK---------------------------
Q05KJ0_BCL2L1-02        SLF-----------------SRK---------------------------
E2IV76_BCL2L1-01        SLF-----------------SRK---------------------------
A0A2K6G3C5_BCL2L1-      SLF-----------------SRK---------------------------
B2Z3Z4_BCL2L1-01        SLF-----------------SRK---------------------------
G3HEA7_BCL2L1-01        SLF-----------------SRK---------------------------
G3HEA7_BCL2L1-02        SLF-----------------SRK---------------------------
A0A1U7T4L4_BCL2L1-      SLF-----------------SRK---------------------------
M3Z2H9_BCL2L1-01        SLF-----------------SRK---------------------------
A0A1U7QU73_BCL2L1-      SLF-----------------SRK---------------------------
A0A0D9RJZ8_BCL2L1-      SLF-----------------SRK---------------------------
A0A286Y5D6_BCL2L1-      SLF-----------------SRK---------------------------
A0A250YD48_BCL2L1-      SLF-----------------SRK---------------------------
A0A1L5BWY3_BCL2L1-      SLF-----------------SRK---------------------------
I3MUP5_BCL2L1-02        SLF-----------------SRK---------------------------
I3MUP5_BCL2L1-03        SLF-----------------SRK---------------------------
I3MUP5_BCL2L1-01        SLF-----------------SRK---------------------------
G1P9D2_BCL2L1-01        SLF-----------------SRK---------------------------
A0A2K5EBP4_BCL2L1-      SLF-----------------SRK---------------------------
E2IV75_BCL2L1-01        SLF-----------------SRK---------------------------
F7IT34_BCL2L1-01        SLF-----------------SRK---------------------------
Q76LT7_BCL2L1-01        SLF-----------------SRK---------------------------
A0A2K5Q6R6_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5Q6R6_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5M8B1_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5H963_BCL2L1-      SLF-----------------SRK---------------------------
Q8SQ42_BCL2L1-01        SLF-----------------SRK---------------------------
A0A2K5VPG2_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K5YR37_BCL2L1-      SLF-----------------SRK---------------------------
A0A2R8Z9D7_BCL2L1-      SLF-----------------SRK---------------------------
A0A096NV05_BCL2L1-      SLF-----------------SRK---------------------------
A0A2J8VIH3_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6QFA2_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6QFA2_BCL2L1-      SLF-----------------SRK---------------------------
A0A2K6UWY8_BCL2L1-      SLF-----------------SRK---------------------------
E2IV77_BCL2L1-01        SLF-----------------SRK---------------------------
A0A452SDS4_BCL2L1-      SLF-----------------SRK---------------------------
A0A384D3U1_BCL2L1-      SLF-----------------SRK---------------------------
A0A452FWV3_BCL2L1-      SLF-----------------SRK---------------------------
Q9MZS7_BCL2L1-01        SLF-----------------SRK---------------------------
D2ITA2_BCL2L1-02        ALL-----------------AKKHV-------------------------
A0A3P9MKK4_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3B3I2Q5_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3P9I2N4_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3B3QRZ2_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B3ZMX9_BCL2L1-      SLL-----------------AQRRL-------------------------
G3NJY1_BCL2L1-01        ---------------------RSDI-------------------------
A0A2U9BY16_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3DUT7_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3DUT7_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3DUT7_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B1JJ42_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3P8UWG7_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3IVF5_BCL2L1-      SLI-----------------IQKRL-------------------------
A0A3Q1DHJ3_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1DHJ3_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1DHJ3_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3P8TL99_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3P8TL99_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1FR00_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B4Z3X2_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B4Z3X2_BCL2L1-      SLI-----------------AQKRL-------------------------
C3VIT1_BCL2L1-01        SLF-----------------AQKRL-------------------------
A0A3P8P0F1_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3Q2X557_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3P9D632_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3P9D632_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3Q4N4B5_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3B4FNX1_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3Q2QPL9_BCL2L1-      SIF-----------------VQKRL-------------------------
A0A3B5PQJ0_BCL2L1-      SIF-----------------AQKRL-------------------------
A0A087X9B7_BCL2L1-      SIF-----------------AQKRL-------------------------
A0A3B3TUS7_BCL2L1-      SIF-----------------AQKRL-------------------------
A0A3B3WI27_BCL2L1-      SIF-----------------AQKRL-------------------------
A0A3P9N9Y4_BCL2L1-      SIF-----------------AQKRL-------------------------
A0A3Q3BEB7_BCL2L1-      VLV-----------------AKKR--------------------------
A0A3P8VMA1_BCL2L1-      VLI-----------------TKKH--------------------------
A0A345BSW9_BCL2L1-      FLQ-----------------FNHKEPL-----------------------
A0A286MU87_BCL2L1-      TLI-----------------MKKRQ-------------------------
A0A3P8XFS0_BCL2L1-      --------------------MENAQWT-----------------------
A0A3P8XFS0_BCL2L1-      TLL-----------------MKKRQ-------------------------
A0A0F7L1T6_BCL2L1-      AFI-----------------VKKH--------------------------
H2U5I3_BCL2L1-01        AFI-----------------VKKH--------------------------
A0A3Q3J5K3_BCL2L1-      VLV-----------------AKKL--------------------------
A0A3Q1EVP6_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3Q1BQA0_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3P8U812_BCL2L1-      VLI-----------------AKKQ--------------------------
E6ZFR0_BCL2L1-01        VLI-----------------AKKH--------------------------
G3P7B4_BCL2L1-01        MVM-----------------VKKR--------------------------
A0A3Q3X5M5_BCL2L1-      VFI-----------------AKKQ--------------------------
A0A2U9BIG9_BCL2L1-      MFI-----------------AKKQ--------------------------
A0A3B3E2W4_BCL2L1-      LLI-----------------AKKR--------------------------
A0A3B3I2Q5_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3P9I2N4_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3P9MKK4_BCL2L1-      VLI-----------------TKKR--------------------------
A0A3B5B4X7_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3B4BFZ8_BCL2L1-      MLI-----------------AKK---------------------------
A0A3Q3FUB6_BCL2L1-      VYI-----------------AKKH--------------------------
A0A3B5MGS2_BCL2L1-      VFV-----------------AKKR--------------------------
M4A558_BCL2L1-01        VFV-----------------AKKR--------------------------
A0A3P9QFB3_BCL2L1-      MFI-----------------AKKR--------------------------
A0A087YBW4_BCL2L1-      MFV-----------------AKKR--------------------------
A0A3B3VWI7_BCL2L1-      MFV-----------------AKKR--------------------------
A0A3B3XN57_BCL2L1-      MFV-----------------AKKR--------------------------
A0A3Q2C6K4_BCL2L1-      VLV-----------------AKKR--------------------------
A0A3Q2NRP4_BCL2L1-      VLF-----------------AKKR--------------------------
A0A0B4KJI5_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3Q1JZ46_BCL2L1-      VLI-----------------AKKR--------------------------
A0A3Q1JZ46_BCL2L1-      VLI-----------------AKKR--------------------------
A0A3Q3NFM4_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3Q3NFM4_BCL2L1-      VLI-----------------AKKQ--------------------------
A0A3B4V9K8_BCL2L1-      VLI-----------------VKKH--------------------------
A0A3B4XS24_BCL2L1-      VLI-----------------VKKH--------------------------
A0A2U9BY16_BCL2L1-      IFS-----------------TARGI-------------------------
C1BLI0_BCL2L1-01        SLI-----------------AKKHH-------------------------
C0HAD8_BCL2L1-01        TLI-----------------MKKRQ-------------------------
A0A3B3ZMX9_BCL2L1-      SLL-----------------AQRRL-------------------------
A0A3B3TFR4_BCL2L1-      FLI-----------------AKKRQ-------------------------
H3CH49_BCL2L1-01        SFI-----------------VMR---------------------------
A0A3Q2FR43_BCL2L1-      SIF-----------------AHKRL-------------------------
A0A3P8XYL5_BCL2L1-      SLI-----------------AQKRL-------------------------
Q90Z98_BCL2L1-02        GLI-----------------AQKRL-------------------------
Q90Z98_BCL2L1-01        GLI-----------------AQKRL-------------------------
A0A059PJI5_BCL2L1-      SFI-----------------AQKRL-------------------------
A0A3B4DTL9_BCL2L1-      SLI-----------------AQKRL-------------------------
B5XAY3_BCL2L1-01        SLF-----------------AQKRL-------------------------
W5MG74_BCL2L1-01        SYI-----------------AKKRL-------------------------
A0A3Q3B3X5_BCL2L1-      SLF-----------------AQKRL-------------------------
A0A3B3IB64_BCL2L1-      SFL-----------------AQKRL-------------------------
A0A3P9JYH1_BCL2L1-      SFL-----------------AQKRL-------------------------
A0A3B3DHA1_BCL2L1-      SFI-----------------AQKRL-------------------------
A0A3Q0RTF8_BCL2L1-      ALI-----------------AQKRL-------------------------
I3IZK7_BCL2L1-01        ALI-----------------AQKRL-------------------------
A0A2U9BY16_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A2U9BY16_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A2U9BY16_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A0D6DR75_BCL2L1-      ALI-----------------AQKRL-------------------------
A0A3Q3WIW8_BCL2L1-      SLI-----------------VQKRL-------------------------
A0A219P0Y3_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3MX20_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3G2E1_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3G2E1_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q3G2E1_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1GZ93_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1GZ93_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3Q1GZ93_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B4V3T1_BCL2L1-      SLI-----------------AQKRL-------------------------
A0A3B4XU17_BCL2L1-      SLI-----------------AQKRL-------------------------
H3ANS8_BCL2L1-01        K-------------------------------------------------
A0A452FHY1_BCL2L1-      RKA-----------------AVSKDTPWLT---------FPSPHAQAY--
A0A452FHY1_BCL2L1-      LQL-----------------IVT--VPFITVIHVLHKLVFPS-FCYSYRD
A0A1S3EPX7_BCL2L1-      SLF-----------------SRK---------------------------
A0A218USB3_BCL2L1-      TDS-----------------CCSCRTRSDPAWGARGLALAH---------
A0A218USB3_BCL2L1-      TRI-----------------SISPLNASVCRWR-----------------
U3JSL7_BCL2L1-01        SLL-----------------SRK---------------------------
A0A218USB3_BCL2L1-      SLL-----------------SRK---------------------------
A0A218USB3_BCL2L1-      SLL-----------------SRK---------------------------
H0Z8G3_BCL2L1-01        SLL-----------------SRK---------------------------
Q4U2V6_BCL2L1-01        SLL-----------------SRK---------------------------
                                                                          

A0A3Q1FR00_BCL2L1-      ---
R4JQR8_BCL2L1-01        ---
A0A346RRN1_BCL2L1-      ---
Q2TAP5_BCL2L1-01        ---
Q91828_BCL2L1-01        ---
I7GKS6_BCL2L1-01        ---
A0A2K5EBP4_BCL2L1-      ---
A0A2K5Q6R6_BCL2L1-      ---
A0A2K6UWY8_BCL2L1-      ---
A0A2K5M8B1_BCL2L1-      ---
A0A2K5H963_BCL2L1-      ---
A0A2K5VPG2_BCL2L1-      ---
A0A2K5YR37_BCL2L1-      ---
A0A2R8Z9D7_BCL2L1-      ---
A0A096NV05_BCL2L1-      ---
A0A2K6QFA2_BCL2L1-      ---
A0A1U7T4L4_BCL2L1-      ---
A0A2K6G3C5_BCL2L1-      ---
A0A3Q1LRT3_BCL2L1-      ---
H9GHK7_BCL2L1-01        ---
Q07816_BCL2L1-04        ---
A0A493TIA6_BCL2L1-      ---
Q07816_BCL2L1-02        ---
Q07816_BCL2L1-03        ---
Q07816_BCL2L1-01        ---
G1N5N5_BCL2L1-01        ---
A0A452ILL8_BCL2L1-      ---
A0A452ILL8_BCL2L1-      ---
K7F655_BCL2L1-01        ---
A0A452E1B1_BCL2L1-      ---
W5PSA5_BCL2L1-01        ---
P53563_BCL2L1-03        ---
P53563_BCL2L1-02        ---
A0A287CZ07_BCL2L1-      ---
F6WA14_BCL2L1-01        ---
G3WKX6_BCL2L1-01        ---
M3XA94_BCL2L1-01        ---
M3XA94_BCL2L1-02        ---
A0A3Q2H0F6_BCL2L1-      ---
H0X6V2_BCL2L1-01        ---
G3SPN0_BCL2L1-01        ---
Q2PFS6_BCL2L1-01        ---
O35843_BCL2L1-01        ---
M3XA94_BCL2L1-03        ---
G1RER8_BCL2L1-01        ---
A0A1S2ZQT6_BCL2L1-      ---
Q64373_BCL2L1-09        ---
Q64373_BCL2L1-01        ---
P53563_BCL2L1-01        ---
O77737_BCL2L1-01        ---
Q9MYW4_BCL2L1-01        ---
A0A3Q2H0F6_BCL2L1-      ---
L8J061_BCL2L1-01        ---
Q05KJ0_BCL2L1-01        ---
Q05KJ0_BCL2L1-02        ---
E2IV76_BCL2L1-01        ---
A0A2K6G3C5_BCL2L1-      ---
B2Z3Z4_BCL2L1-01        ---
G3HEA7_BCL2L1-01        ---
G3HEA7_BCL2L1-02        ---
A0A1U7T4L4_BCL2L1-      ---
M3Z2H9_BCL2L1-01        ---
A0A1U7QU73_BCL2L1-      ---
A0A0D9RJZ8_BCL2L1-      ---
A0A286Y5D6_BCL2L1-      ---
A0A250YD48_BCL2L1-      ---
A0A1L5BWY3_BCL2L1-      ---
I3MUP5_BCL2L1-02        ---
I3MUP5_BCL2L1-03        ---
I3MUP5_BCL2L1-01        ---
G1P9D2_BCL2L1-01        ---
A0A2K5EBP4_BCL2L1-      ---
E2IV75_BCL2L1-01        ---
F7IT34_BCL2L1-01        ---
Q76LT7_BCL2L1-01        ---
A0A2K5Q6R6_BCL2L1-      ---
A0A2K5Q6R6_BCL2L1-      ---
A0A2K5M8B1_BCL2L1-      ---
A0A2K5H963_BCL2L1-      ---
Q8SQ42_BCL2L1-01        ---
A0A2K5VPG2_BCL2L1-      ---
A0A2K5YR37_BCL2L1-      ---
A0A2R8Z9D7_BCL2L1-      ---
A0A096NV05_BCL2L1-      ---
A0A2J8VIH3_BCL2L1-      ---
A0A2K6QFA2_BCL2L1-      ---
A0A2K6QFA2_BCL2L1-      ---
A0A2K6UWY8_BCL2L1-      ---
E2IV77_BCL2L1-01        ---
A0A452SDS4_BCL2L1-      ---
A0A384D3U1_BCL2L1-      ---
A0A452FWV3_BCL2L1-      ---
Q9MZS7_BCL2L1-01        ---
D2ITA2_BCL2L1-02        ---
A0A3P9MKK4_BCL2L1-      ---
A0A3B3I2Q5_BCL2L1-      ---
A0A3P9I2N4_BCL2L1-      ---
A0A3B3QRZ2_BCL2L1-      ---
A0A3B3ZMX9_BCL2L1-      ---
G3NJY1_BCL2L1-01        ---
A0A2U9BY16_BCL2L1-      ---
A0A3Q3DUT7_BCL2L1-      ---
A0A3Q3DUT7_BCL2L1-      ---
A0A3Q3DUT7_BCL2L1-      ---
A0A3B1JJ42_BCL2L1-      ---
A0A3P8UWG7_BCL2L1-      ---
A0A3Q3IVF5_BCL2L1-      ---
A0A3Q1DHJ3_BCL2L1-      ---
A0A3Q1DHJ3_BCL2L1-      ---
A0A3Q1DHJ3_BCL2L1-      ---
A0A3P8TL99_BCL2L1-      ---
A0A3P8TL99_BCL2L1-      ---
A0A3Q1FR00_BCL2L1-      ---
A0A3B4Z3X2_BCL2L1-      ---
A0A3B4Z3X2_BCL2L1-      ---
C3VIT1_BCL2L1-01        ---
A0A3P8P0F1_BCL2L1-      ---
A0A3Q2X557_BCL2L1-      ---
A0A3P9D632_BCL2L1-      ---
A0A3P9D632_BCL2L1-      ---
A0A3Q4N4B5_BCL2L1-      ---
A0A3B4FNX1_BCL2L1-      ---
A0A3Q2QPL9_BCL2L1-      ---
A0A3B5PQJ0_BCL2L1-      ---
A0A087X9B7_BCL2L1-      ---
A0A3B3TUS7_BCL2L1-      ---
A0A3B3WI27_BCL2L1-      ---
A0A3P9N9Y4_BCL2L1-      ---
A0A3Q3BEB7_BCL2L1-      ---
A0A3P8VMA1_BCL2L1-      ---
A0A345BSW9_BCL2L1-      ---
A0A286MU87_BCL2L1-      ---
A0A3P8XFS0_BCL2L1-      ---
A0A3P8XFS0_BCL2L1-      ---
A0A0F7L1T6_BCL2L1-      ---
H2U5I3_BCL2L1-01        ---
A0A3Q3J5K3_BCL2L1-      ---
A0A3Q1EVP6_BCL2L1-      ---
A0A3Q1BQA0_BCL2L1-      ---
A0A3P8U812_BCL2L1-      ---
E6ZFR0_BCL2L1-01        ---
G3P7B4_BCL2L1-01        ---
A0A3Q3X5M5_BCL2L1-      ---
A0A2U9BIG9_BCL2L1-      ---
A0A3B3E2W4_BCL2L1-      ---
A0A3B3I2Q5_BCL2L1-      ---
A0A3P9I2N4_BCL2L1-      ---
A0A3P9MKK4_BCL2L1-      ---
A0A3B5B4X7_BCL2L1-      ---
A0A3B4BFZ8_BCL2L1-      ---
A0A3Q3FUB6_BCL2L1-      ---
A0A3B5MGS2_BCL2L1-      ---
M4A558_BCL2L1-01        ---
A0A3P9QFB3_BCL2L1-      ---
A0A087YBW4_BCL2L1-      ---
A0A3B3VWI7_BCL2L1-      ---
A0A3B3XN57_BCL2L1-      ---
A0A3Q2C6K4_BCL2L1-      ---
A0A3Q2NRP4_BCL2L1-      ---
A0A0B4KJI5_BCL2L1-      ---
A0A3Q1JZ46_BCL2L1-      ---
A0A3Q1JZ46_BCL2L1-      ---
A0A3Q3NFM4_BCL2L1-      ---
A0A3Q3NFM4_BCL2L1-      ---
A0A3B4V9K8_BCL2L1-      ---
A0A3B4XS24_BCL2L1-      ---
A0A2U9BY16_BCL2L1-      ---
C1BLI0_BCL2L1-01        ---
C0HAD8_BCL2L1-01        ---
A0A3B3ZMX9_BCL2L1-      ---
A0A3B3TFR4_BCL2L1-      ---
H3CH49_BCL2L1-01        ---
A0A3Q2FR43_BCL2L1-      ---
A0A3P8XYL5_BCL2L1-      ---
Q90Z98_BCL2L1-02        ---
Q90Z98_BCL2L1-01        ---
A0A059PJI5_BCL2L1-      ---
A0A3B4DTL9_BCL2L1-      ---
B5XAY3_BCL2L1-01        ---
W5MG74_BCL2L1-01        ---
A0A3Q3B3X5_BCL2L1-      ---
A0A3B3IB64_BCL2L1-      ---
A0A3P9JYH1_BCL2L1-      ---
A0A3B3DHA1_BCL2L1-      ---
A0A3Q0RTF8_BCL2L1-      ---
I3IZK7_BCL2L1-01        ---
A0A2U9BY16_BCL2L1-      ---
A0A2U9BY16_BCL2L1-      ---
A0A2U9BY16_BCL2L1-      ---
A0A0D6DR75_BCL2L1-      ---
A0A3Q3WIW8_BCL2L1-      ---
A0A219P0Y3_BCL2L1-      ---
A0A3Q3MX20_BCL2L1-      ---
A0A3Q3G2E1_BCL2L1-      ---
A0A3Q3G2E1_BCL2L1-      ---
A0A3Q3G2E1_BCL2L1-      ---
A0A3Q1GZ93_BCL2L1-      ---
A0A3Q1GZ93_BCL2L1-      ---
A0A3Q1GZ93_BCL2L1-      ---
A0A3B4V3T1_BCL2L1-      ---
A0A3B4XU17_BCL2L1-      ---
H3ANS8_BCL2L1-01        ---
A0A452FHY1_BCL2L1-      ---
A0A452FHY1_BCL2L1-      LTI
A0A1S3EPX7_BCL2L1-      ---
A0A218USB3_BCL2L1-      ---
A0A218USB3_BCL2L1-      ---
U3JSL7_BCL2L1-01        ---
A0A218USB3_BCL2L1-      ---
A0A218USB3_BCL2L1-      ---
H0Z8G3_BCL2L1-01        ---
Q4U2V6_BCL2L1-01        ---
                           

© 1998-2020Legal notice