Dataset for protein Bfl1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtqpgtrfwrgsehsiradsakakvpyvisvpgwearlrdpegstrpppgpqglpgtlmtnvsigkerkkdwrfslflpg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rladpegtagwgwqqnpqdlpaqrfrkvntqifqrrskveqgprlpdmsplvtgsytrrrsswkrslppwgsmrswptpe
                                               frhgfg qpdaq cagepragavefgflk    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------MtdcEFgyiyrLaqdYlqyVLQipq
sdeeegagpvvhtemptestpasaspmsprqprahrrliwsxxxxxxxxxaggpr-eey--m-vhs-teh-vkh---vsa
              ihpaipcrperhpehspsppgcasgsprgtrlpsrrxlpwt atsvlyhtly v-- -r-iqkeqh
               ghills titssltpslwssawfsctwqwtwqlqs   rk --a y-s--n -rn  -c  r---
                      m g lis h sl ll d lfdlqsa         sst  rf rm  l   wd   t r
                           dl e a   c                   d -  h  qt      l    m t
                                                        n h  d   a      d      p
                                                        i g  w   -             e
                                                          l  c   k              
                                                          d      g              
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           *.   
pgsgpsktsrVLqkvAfSvQkevEknlkpcLDnvnvvSidtArtiFnqVMekeFeDGiiNWGRIvTiFaFeGiLiKKLlr
fepaqtraah--rni-s-l-dqt-es-rsy--dfdia-van-krl-sg--dek-a--nt-----m-v-t-g-vst rtqq
l-tk--qvcqi -dmm-f- g--g-av-qffssih-epm-at-i-a-slv-tqe-n vvrg tclv-amv-alil  spe
ss--ln----a  r- l   -dn r-me--  rl-ct -lvhq-h t-ipt-- g  --     - m -la s s   sp
-alsah ifk   -s     e   qt  tl  t-v g ags  m  p   kas d  rm     t   v     v   at
c mcs        ta     n    d  lw  kma -  e-  s  k           g     h         m    s
r av         q      r    r  a   -   s   c  g  i                           a    g
             h      q    i          r         g                                 
                                    i                                           
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :                                                                
qriapdvdtykeiSyFvaEfImnntgeWIrqNGGW------------------------------------engfvkkfe
eqvqltmgakeqvfslit-y-tt-ka--gdah-e-viahsqyqkskrisiflsmqdeieteeiirdifqqggk-------
hgtssggeesr-seh --s-viktmrg -kr-n- ellpp   n                    k   k  -dcsitryq
kcdpqratmcqke q rq ht-eya-d  si h  s                                   ktsqlpnlr
raag acrnlsd  n     lv-r-sa  q-    d                                   v-a trmck
splc  rcc- t  r      lrqi q  -                                         di  mng  
ak k  l sr a  f       sh     e                                         ah       
 e      kq    c       h                                                 s       
         h            d                                                 l       
         d                                                              c       
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pk---sgw----ltflevtgkicemlsllkq-y-----------------------------------------------
--sgy--hhslmmshmpm---lvasvahk--y-clhqpgeeevreealstggldlilmpglgfdkhgnrlgrgkgyydty
er   rsl    hnlvqiaaqfw-iffrfrkkmaitglaggdangtihnvypyrnnflfrtvt  d              
fn   tn-    -dmsklssp-edvscfpetswysredpfstlm dhal lfwfk snddd                   
tq   qvp    p---r-mdlv-s-----srflne   i lfd       aafa  na                      
r    ppv    vvkt-tlttmigtwlqrqehhsa                                             
q    mag    smeflskriksrlmtvidnt l                                              
h    a      re rdaim  mnaeps  dp                                                
            n  at v   lik ie  a                                                 
                n     a g                                                       
                g     k c                                                       
                f                                                               

       490       500       510       520       
....:....|....:....|....:....|....:....|....:..
                                               
-----------------------------------------------
lkrcvqhqevkpytlalafkeqicvqvpvdendmkvdevlyedssas
    l                   p      h           cp  
                                               
                                               
                                               
                                               
                                               
                                               
                                               
                                               
                                               
© 1998-2020Legal notice