Dataset for protein Bfl1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtqpgtrfwrgsehsiradsakakvpyvisvpgwearlrdpegstrpppgpqglpgtlmtnvsigkerkkdwrfslflpg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rladpegtagwgwqqnpqdlpaqrfrkvntqifqrrskveqgprlpdmsplvtgsytrrrsswkrslppwgsmrswptpe
                                               frhgfg qpdaq cagepragavefgflk    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------MtdcefgyiyrLaqdYlqyvlqipq
sdeeegagmvvmivpasasslrpeskqslrqpsagrrlgssxxxxxpxxxaggrk-aey--m-vhs-teh--kh---v-a
        phthttsspsrtm a lhprp pvrpsqwsswprkwtwxsrsxqpprle--vl-htly ---rvr-iqkeq-
         aaeapiplkgpc      eh asp hegficlqgtrsqlqrslswt -ts iys--n vsn i-cf s-sh
         ghale ga  h       d  emf eaa   ffdkql allreqql sst yrfsq- krk tli  rt t
           i l  t               a  cc                   dqa  h  rt  l   wd   m r
                                                        n d  d   m      s    g d
                                                        i h  a   g      e      p
                                                          g  w   a      d      e
                                                          k  c   k              
                                                          l                     
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pgsgpsktsrvLqkvafsvQkeveknlkpcldnvnvvSidtarti---------FnqvMekeFeDGiiNWGRIvTiFaFe
fepa--raah--rd--s-l-d---e---sy--dfdia-v-n-kilsslpktswn-s---dek-a--nv-maaamavstag
l---qtqv--ii-nit-q-k-qti-amr--sssih-ek-asp-r-         i-gpg---i-eevtstmgllla-g-k
-stkln--cqa  rmfqfi gcngrsyqqffnr--mtrme-te-p         thsivktrgrn --hv   d   -l-
salceieifk   -sml g ndf qtvetlchklp - lha sm           k e  n  dg al     a   m  
c msah  ee   ta     e   pr  lq a-mv r ggv qe           t    g     tm     t   v  
r avs        q      q    d  fw  t l g a c  s           i           c         s  
   h         h      t    k  ma  h   s      l           g                        
                    r    i  a   p   i                  a                        
                                    h                                           
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                                                       
GiLiKKLlrqriapdvdtykeiSyFvaEfimnntgeWIrqNGGW------------------------------------
rv-tae-qqeqvqltmeakeqv-slitqy-t--ma---kr---kviahrqyqkskrisiflsmpdeieteeiikdifqqg
-lil--tpekgrsssagecr-qph l---gierk-qrldahke- ft ne ln q v      q         r   r  
 s r r kghcap--g-mrld-ff -pglv-kt-rn g--gn y    s                            k  
 - v   a-rltgig-t-s-rs n m   tfthisg  si h                                      
   s   -t---v acsn-qk  -      vrya d  q                                         
   m   sssad-  rccf t  r       d c a  g                                         
   -      psc    sl s  q       s      e                                         
   a      k      kh    c       h                                                
                  q                                                             
                  d                                                             
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e----ngfvkkfe--------------------pk---------------------------------------------
gllppk-------lqsnhmdmvklaspeeisll--tswnihqpgesdvreealstggldlifvpglgreepsaqgrffdk
k    dcyipryrf        r   ad  as ersgvvtqlesidetl    a dahmqtsmevyl         lssr
-    tasltncq                    tnqdy  f  a gqiw           m l  m           lpq
y    vsqtrmll                    qsapg     t n a              r              dkn
d    -  mng k                    h                                             l
v    i                           r                                             d
s    h                                                                          
a    s                                                                          
     l                                                                          
     c                                                                          
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------sgw----ltflevtgkicemlsllkq-y---------------------------
qgnrlgrgkgyydaylkrclqsqdv--yhslmmnhmpm---lvlsvahke-ymcldevlyedspaslantyfyfnnsnfr
dsrlgrgkr sfptl qvlvrhsgakp-    hsa-aikeqfwaqfpv--kk-avtglifltvmetihpvlpfakinadd
gtl a edp  c n  tl emq elrsl    tlltqfsal---v-frfrrdvyerqrptvqlavnh l           
eng          l  lk   w h tvf    ---s--rttvsp-sc-ddnplksicicislcnslc             
c                        mtp    pivvdtiditldtw-frstfwsg  f gpfaqld              
a                        lqv    vekflsarnsiilttqnthhhla  d    r g               
                         qdh    yvcakgvnfkagamimpqet          d                 
                         pae    sr cg lm  msre si pa                            
                         g      rm  t     krk  eg d                             
                                ng  n      ni     a                             
                                fa  s      kg                                   
                                    r       c                                   
                                    f                                           

   
...
   
---
tvt
d  
   
   
   
   
   
   
   
   
   
   
   
© 1998-2020Legal notice