Dataset for protein Bfl1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtqpgtrfwrgsehsiradsakakvpyvisvpgwearlrdpegstrpppgpqglpgtlmtnvsigkerkkdwrfslflpg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rladpegtagwgwqqnpqdlpaqrfrkvntqifqrrskveqgprlpdmsplvtgsytrrrsswkrslppwgsmrswptpe
                                               frhgfg qpdaq cagepragavefgflk    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------MtdcEFgYiyrLaqdYlqyVLQipq
sdeeegagpvvhtemptestpasasppsprqpragrrliwsxxxxxxxxxxggpr-eey-lmhvhs-teh-vkh---vsa
              ihpaipcrperhmeh pspphaasgsprgtrlpsrra pwk atsv-y-tly v-- -r-iqreqh
               ghills t gsldl e a  cc                   ssa yrs--n -rn  -c   --r
                                                        d-t  -f rm  l   wd   t -
                                                        - h  h  qt      l    m p
                                                        n g  d   a      d      e
                                                        i -  w   k              
                                                          l  c   -              
                                                          d      g              
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        :: *.   
pgsgpsktsrVLqkvAfSvQkevEknlkpcLDnvnvvSiDtArtiFnqVMekeFeDGiiNWGRIvTIFaFeGiLiKKLlr
lepaqtraah--rni-s-l-dqt-es-rsy--dfdia-van-krl-sg--dek-a--nt-----m-v-t-g-vit rtqq
f-tk--qvcqi -dmm-f- g--grav-qffssih-e --at-i- --iv-tq -n vv     l - ml- l   pe
ss--ln----a  r- l   edn --me-l  rl- t mgv q-  ts  k-- d  --     -   -     s   sp
-alsah ifk   ts     -   qt  t-  t-v g aes  m  k           m     t   v     v    t
c mcs        -a     n    d  aw  k   -   -  s  i                           m    s
r av         q      r    r      -   s   c     g                                g
             h      q    i          i                                           
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *           *   :                                                
qriapdvdtykeiSyFvaEfImnNtgeWIrqNGGWe------------------------------------ngfvkkfe
eqvqltmeakeqvfs it-y-tk-ma- gdahne-gllpsqyqkskrisiflsmqdeieteeiirdifqqgkk-------
hgtssgggesr-s h -- -vittkrg  kr h  viahp                                dahltyqk
kcdp aatmcqk  q     t-eya-d  si    -                                    -csiqnlq
raac  ccn- d  f      v-r-sa  q     d                                    i  tpmy 
sp g  r cl t  c       rhi q  e     s                                    h  srrc 
 k      sr            s            a                                    t   ng  
        kq            h                                                 s       
         h            d                                                 l       
         d                                                              c       
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pks---gw----ltflevtgkicemlsllkqyy-----------------------------------------------
---gys--hslmmshmpm---lvasvahkr---algktcfipryqfnsntmdmvklaspeeilslpktswnihqpgeeev
err   sl    hnlsqimaqfw-vffrf-kkcqqtqpieltvretilshygyflinnfglvtdkhgnrlgrgkgyydty
tnt   vp    ---fl-sdl-idt-cf-erfmnshglg eelm eaa  gfld  lm ddgf                 
s q   pv    pvi-kslttv-s-e--rseifci                                             
r p   ns    immv-lkqiesglweqiddhw e                                             
q m   ah    sektdaasdmmristip tss                                               
h a    g    rdert vrpklnampv  npl                                               
f           q  ar im  aik ie    h                                               
            n   n     k g                                                       
                g     e c                                                       
                f                                                               

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
reealstqgwrpytmpllgkeqigvrvpvgknyykvylvrylqssevkpytlalafkeqicvqvpvdendmkvdevlyed
lkrc qhgevklillagaffdkhcnqlgrdegdmdtdeklcedhqas                                 
       aald                                                                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

    
....
    
----
ssas
    
    
    
    
    
    
    
    
    
    
© 1998-2020Legal notice