Dataset for protein Bfl1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

76 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E2RS00_BCL2A1-01        MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPG
E2RS00_BCL2A1-02        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        PQGLPGTLMTNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDL
E2RS00_BCL2A1-02        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        PAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPW
E2RS00_BCL2A1-02        ---------------------------MSHLFGGSYDAQRCSGERRLPAV
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        ESGRSKPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
E2RS00_BCL2A1-02        GFMFLWPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      ------------------------MGHILLSATAGSLDLREPAAGCCL--
A0A452U285_BCL2A1-      ------------------------MHTEIPPASARPMSHRPSPAGARLIW
A0A452U285_BCL2A1-      ------------------------MHTEIPPASARPMSHRPSPAGARLIW
                                                                          

E2RS00_BCL2A1-01        SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
E2RS00_BCL2A1-02        SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
H0ZCL9_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
U3JTB2_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
A0A218V8Z6_BCL2A1-      ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
Q9W6F2_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
A0A493SSZ7_BCL2A1-      ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
G1N8C5_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAH
A0A452J3N6_BCL2A1-      ---------------MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAH
K7G130_BCL2A1-01        ---------------MESSEFRYVYYLVQDYLKYILQEPELGPAPSRVAH
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ---------------MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
F6SFL4_BCL2A1-01        ---------------MDDYEFHYVHMLARDYLKHVQQTPPLGSCLNKTSQ
G3WSP8_BCL2A1-01        ---------------MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQ
A0A2K5PYQ3_BCL2A1-      ---------------MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSR
A0A2K5PYQ3_BCL2A1-      ---------------MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSR
F6S8G3_BCL2A1-01        ---------------MDDGVFWSVRALALDYLDDVLQTPRLGTVPSRTSR
O55178_BCL2A1-01        ---------------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFR
Q0P538_BCL2A1-01        ---------------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFR
G3V977_BCL2A1-01        ---------------MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSR
Q925A9_BCL2A1-01        ---------------MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSR
Q07440_BCL2A1-01        ---------------MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACR
O55179_BCL2A1-01        ---------------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
O55177_BCL2A1-02        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
Q497M6_BCL2A1-01        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACR
Q8K164_BCL2A1-01        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
Q4FK02_BCL2A1-01        ---------------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACR
A0A452SIR9_BCL2A1-      ---------------MTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
M3YVH4_BCL2A1-01        ---------------MTDSEFGYTLSLAQDYVRHVLQIPQPSPAASRVSR
U6CQS8_BCL2A1-01        ---------------MTDGEFGYTLSLAQDYVRHVLQIPQPGPAASRVSR
I3MCZ7_BCL2A1-01        ---------------MNDCEFRFIHTLAQDYLQHVLQVPQRGSSPSKTSK
G3T8E6_BCL2A1-01        ---------------MTDCEFGYIYKLVQDYLKYVLQIPQPAAGSSKTSR
H0WZ23_BCL2A1-01        ---------------MTDCEFGYIHRLAQDYLQYVLQIQQCGSGPSKTSR
A0A2I3HBP6_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5D2I1_BCL2A1-      ---------------MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
B4E1X9_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSR
A0A2I2YML2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2R8ZJX9_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSR
A0A2I3HBP6_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6PHF2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6LV19_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5TMD1_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KAA3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6DS18_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A096NMX5_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSR
A0A2K6AD27_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6TLJ5_BCL2A1-      ---------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
F7HXW0_BCL2A1-01        ---------------MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSR
A0A2K6TLJ5_BCL2A1-      ---------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
A0A2K6EKG1_BCL2A1-      ---------------MTDCEFGYTHRLVQDYLQYVLRVPQPGSGPSKTSR
A0A452EK63_BCL2A1-      ---------------MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSR
W5Q0N6_BCL2A1-01        ---------------MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSR
L8IZT5_BCL2A1-01        ---------------MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISR
Q3C2I0_BCL2A1-01        ---------------MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSR
F7CP56_BCL2A1-04        ---------------MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
C7F841_BCL2A1-01        ---------------MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
A0A2K5D2I1_BCL2A1-      ---------------MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
H2NNZ9_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKASR
A0A2I2YML2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6LV19_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6PHF2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KHH8_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KHH8_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KAA3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5TMD1_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
F7E8V5_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6DS18_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6AD27_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A096NMX5_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSR
A0A0D9RRC3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
Q16548_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSR
A0A2R8ZJX9_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSR
F7CP56_BCL2A1-03        ---------------MTDC-------------------------------
A0A286XUI2_BCL2A1-      ------------PPRMIDLEFRYTQALAQDYLLHVLQVPQCETSPSKASK
A0A452U285_BCL2A1-      PXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
A0A452U285_BCL2A1-      PXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
                                                                          

E2RS00_BCL2A1-01        VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
E2RS00_BCL2A1-02        VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
H0ZCL9_BCL2A1-01        VLRTMASSLQDQTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFADGNTN
U3JTB2_BCL2A1-01        VLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTN
A0A218V8Z6_BCL2A1-      VLRTMASSLQDQTEEAVRPLLDRIDISSVAVAKRIFNGVMDEKFADGNTN
Q9W6F2_BCL2A1-01        VLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTN
A0A493SSZ7_BCL2A1-      VLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFADGNTN
G1N8C5_BCL2A1-01        VLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTN
A0A452J3N6_BCL2A1-      VLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFADGNTN
K7G130_BCL2A1-01        VLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFDDGNTN
F7CP56_BCL2A1-02        ---------------------------------------MEKQFEDGIIN
F7CP56_BCL2A1-01        VLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIIN
F6SFL4_BCL2A1-01        ILQKVAFSVQQEVEKDMETCLSTLDIVSVESARRIFNSVMKKEFEDGVIN
G3WSP8_BCL2A1-01        ILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFEDGIIN
A0A2K5PYQ3_BCL2A1-      VLQKVAFSVQ-------KPCLDNVNIVSIDNARTIFSQVMETEFEDGIIN
A0A2K5PYQ3_BCL2A1-      VLQKVAFSVQ-------KPCLDNVNIVSIDNARTIFSQVMETEFEDGIIN
F6S8G3_BCL2A1-01        ALQNVMFSVQGDVEKALKPCFDSLDVGSVGAARRIFGQIVEKEFEDGIVN
O55178_BCL2A1-01        VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFEDGIIN
Q0P538_BCL2A1-01        VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGIIN
G3V977_BCL2A1-01        VLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q925A9_BCL2A1-01        VLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q07440_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
O55179_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
O55177_BCL2A1-02        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q497M6_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q8K164_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q4FK02_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
A0A452SIR9_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
M3YVH4_BCL2A1-01        VLRDVASSVQGEVEQNLRPCLDSFDVGSIDTARTIFNQVMEKEFEDGIIN
U6CQS8_BCL2A1-01        VLRDVASSVQREVEQNLKPCLDSFDVGSIDTARTIFNQVMEKEFEDGIIN
I3MCZ7_BCL2A1-01        VLQNVAFSVQKEVEKNLKPFLDNFDVVSADTARTIFNQVMEKEFEDGIMN
G3T8E6_BCL2A1-01        VLQNVAFSVQKEVEKNLKPCLDNFVVISIDTAQTIFKQVMEKEFEDGIIN
H0WZ23_BCL2A1-01        VLQNVAFSVQEEVEKSLKPCLDNFNVVSIDTARTIFNQVMEKEFEDGIIN
A0A2I3HBP6_BCL2A1-      VLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K5D2I1_BCL2A1-      VLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFEDGIIN
B4E1X9_BCL2A1-01        VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I2YML2_BCL2A1-      VLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2R8ZJX9_BCL2A1-      VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I3HBP6_BCL2A1-      VLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K6PHF2_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6LV19_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5TMD1_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KAA3_BCL2A1-      VLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIIN
A0A2K6DS18_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A096NMX5_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6AD27_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6TLJ5_BCL2A1-      VLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIIN
F7HXW0_BCL2A1-01        VLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFEDGIIN
A0A2K6TLJ5_BCL2A1-      VLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIIN
A0A2K6EKG1_BCL2A1-      VLQNIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFEDGIVN
A0A452EK63_BCL2A1-      VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
W5Q0N6_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
L8IZT5_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
Q3C2I0_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
F7CP56_BCL2A1-04        VLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIIN
C7F841_BCL2A1-01        VLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIIN
A0A2K5D2I1_BCL2A1-      VLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFEDGIIN
H2NNZ9_BCL2A1-01        VLQKVAFSVQKEVEKNLKPCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I2YML2_BCL2A1-      VLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K6LV19_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6PHF2_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KHH8_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KHH8_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KAA3_BCL2A1-      VLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIIN
A0A2K5TMD1_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
F7E8V5_BCL2A1-01        VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6DS18_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6AD27_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A096NMX5_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A0D9RRC3_BCL2A1-      VLQKVASSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
Q16548_BCL2A1-01        VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2R8ZJX9_BCL2A1-      VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      VLQDMALSVQEEVERRLKPWLDRIDVESIDTAKSIFNQVMEKEFEDGIIN
A0A452U285_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
A0A452U285_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
                                                                          

E2RS00_BCL2A1-01        WGRIVTVFAFEGILTKKLLEQRISSDVDA-EKVSYFVAEFITRNMRDWIR
E2RS00_BCL2A1-02        WGRIVTVFAFEGILTKKLLEQRISSDVDA-EKVSYFVAEFITRNMRDWIR
H0ZCL9_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWID
U3JTB2_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWID
A0A218V8Z6_BCL2A1-      WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWID
Q9W6F2_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISYFITEYIINNKAAWID
A0A493SSZ7_BCL2A1-      WGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWID
G1N8C5_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWID
A0A452J3N6_BCL2A1-      WGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIE
K7G130_BCL2A1-01        WGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWID
F7CP56_BCL2A1-02        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
F7CP56_BCL2A1-01        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
F6SFL4_BCL2A1-01        WGRIVTIFAFGGILIKKLLRHRAPLTMGTQEEISHFIAEFIMNNIAEWIR
G3WSP8_BCL2A1-01        WGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIR
A0A2K5PYQ3_BCL2A1-      WGRIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIR
A0A2K5PYQ3_BCL2A1-      WGRIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIR
F6S8G3_BCL2A1-01        WGRIVTIFVLGGILTKKLQRSGVPLTRETREEISCFIAEFTTHHAGEWIR
O55178_BCL2A1-01        WGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQF-----------WGR
Q0P538_BCL2A1-01        WGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQF-----------WGR
G3V977_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQ
Q925A9_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQ
Q07440_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIR
O55179_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIR
O55177_BCL2A1-02        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q497M6_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q8K164_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q4FK02_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
A0A452SIR9_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
M3YVH4_BCL2A1-01        WGRIVTVFAFEGILSKKLLRERISPDVDASR-VSYFVAEFITTNMREWIR
U6CQS8_BCL2A1-01        WGRIVTVFAFEGILSKKLLRERISPDVDASR-VSYFVAEFITTNMREWIR
I3MCZ7_BCL2A1-01        WGRIVTIFAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIR
G3T8E6_BCL2A1-01        WGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWIR
H0WZ23_BCL2A1-01        WGRIVTIFAFGGILLKKLLQQRIALDVDTYKEISYFVAEFIMNYTGEWIR
A0A2I3HBP6_BCL2A1-      WGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIS
B4E1X9_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2I3HBP6_BCL2A1-      WGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6PHF2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6LV19_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5TMD1_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KAA3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6DS18_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6AD27_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6TLJ5_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIR
F7HXW0_BCL2A1-01        WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIR
A0A2K6TLJ5_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6EKG1_BCL2A1-      WGRIVTVFAFGGILIKKLLREQIALDVDTYKEISYFIAEFITNNAGEWIR
A0A452EK63_BCL2A1-      WGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIR
W5Q0N6_BCL2A1-01        WGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITKNTGEWIR
L8IZT5_BCL2A1-01        WGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIK
Q3C2I0_BCL2A1-01        WGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIK
F7CP56_BCL2A1-04        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
C7F841_BCL2A1-01        WGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIR
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIS
H2NNZ9_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFVMNNTGGWIK
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6LV19_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6PHF2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KHH8_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KHH8_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KAA3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5TMD1_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
F7E8V5_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6DS18_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6AD27_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A0D9RRC3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFITNNTGEWIR
Q16548_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
F7CP56_BCL2A1-03        ------------ILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
A0A286XUI2_BCL2A1-      WGRIVTIFAFGGVILKKLPREPIAPDVDTYKEISYFVAEFIMSRMGGWIR
A0A452U285_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
A0A452U285_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
                                    :: *.                  *           *  

E2RS00_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
E2RS00_BCL2A1-02        QNGGWE------------------------------------NGFVKKFE
H0ZCL9_BCL2A1-01        ANGGWE------------------------------------NGFLTKF-
U3JTB2_BCL2A1-01        ANGGWE------------------------------------NGFLTKF-
A0A218V8Z6_BCL2A1-      ANGGWE------------------------------------NGFLTKF-
Q9W6F2_BCL2A1-01        ANGGWE------------------------------------NGFLTKF-
A0A493SSZ7_BCL2A1-      ANGGWE------------------------------------NGFLTKF-
G1N8C5_BCL2A1-01        ANGGWE------------------------------------NGFLTKF-
A0A452J3N6_BCL2A1-      ANGGWE------------------------------------NGFLTMFE
K7G130_BCL2A1-01        ANGGWE------------------------------------NGFLPMFE
F7CP56_BCL2A1-02        QNGGWV------------------------------------IAHSQYQK
F7CP56_BCL2A1-01        QNGGWV------------------------------------IAHSQYQK
F6SFL4_BCL2A1-01        QNGGWE------------------------------------NGFVKNFE
G3WSP8_BCL2A1-01        QNGGWE------------------------------------NGFIKNFE
A0A2K5PYQ3_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K5PYQ3_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
F6S8G3_BCL2A1-01        QNGGWE------------------------------------NGFLNKFE
O55178_BCL2A1-01        IHNE----------------------------------------------
Q0P538_BCL2A1-01        IHHE----------------------------------------------
G3V977_BCL2A1-01        QNGGWE------------------------------------DGFTKKFE
Q925A9_BCL2A1-01        QNGGWE------------------------------------DGFTKKFE
Q07440_BCL2A1-01        QNGGWE------------------------------------DGFIKKFE
O55179_BCL2A1-01        RNGGWE------------------------------------DGFIKKFE
O55177_BCL2A1-02        RNGGWE------------------------------------DGFIKKFE
Q497M6_BCL2A1-01        RNGGWE------------------------------------DGFIKKFE
Q8K164_BCL2A1-01        RNGGWE------------------------------------DGFIKKFE
Q4FK02_BCL2A1-01        RNGGWE------------------------------------DGFIKKFE
A0A452SIR9_BCL2A1-      QNGGWE------------------------------------DGFVKKFE
M3YVH4_BCL2A1-01        QNGGWE------------------------------------DGFVKKFE
U6CQS8_BCL2A1-01        QNGGWE------------------------------------DGFVKKFE
I3MCZ7_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
G3T8E6_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
H0WZ23_BCL2A1-01        QNGGWE------------------------------------HGFVKKFE
A0A2I3HBP6_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K5D2I1_BCL2A1-      QNGGWA------------------------------------K-------
B4E1X9_BCL2A1-01        QNGGWV------------------------------------C-------
A0A2I2YML2_BCL2A1-      QNGGWG------------------------------------K-------
A0A2R8ZJX9_BCL2A1-      QNGGWG------------------------------------K-------
A0A2I3HBP6_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K6PHF2_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K6LV19_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K5TMD1_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K5KAA3_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K6DS18_BCL2A1-      QNGGWG------------------------------------K-------
A0A096NMX5_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K6AD27_BCL2A1-      QNGGWG------------------------------------K-------
A0A2K6TLJ5_BCL2A1-      RNGGWD------------------------------------L-------
F7HXW0_BCL2A1-01        QNGGWG------------------------------------K-------
A0A2K6TLJ5_BCL2A1-      RNGGWG------------------------------------K-------
A0A2K6EKG1_BCL2A1-      QNGGWE------------------------------------HGFVKKFE
A0A452EK63_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
W5Q0N6_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
L8IZT5_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
Q3C2I0_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
F7CP56_BCL2A1-04        QNGGWE------------------------------------NGFVKKFE
C7F841_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
A0A2K5D2I1_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
H2NNZ9_BCL2A1-01        QNGGWE------------------------------------NGFVKKLE
A0A2I2YML2_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K6LV19_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K6PHF2_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K5KHH8_BCL2A1-      QNGGWE------------------------------------NGFVKKLE
A0A2K5KHH8_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K5KAA3_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K5TMD1_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
F7E8V5_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
A0A2K6DS18_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A2K6AD27_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A096NMX5_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
A0A0D9RRC3_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
Q16548_BCL2A1-01        QNGGWE------------------------------------NGFVKKFE
A0A2R8ZJX9_BCL2A1-      QNGGWE------------------------------------NGFVKKFE
F7CP56_BCL2A1-03        QNGGWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQ
A0A286XUI2_BCL2A1-      QNGGWD------------------------------------NGFVRKFE
A0A452U285_BCL2A1-      QNGGWE------------------------------------DGFVKKFE
A0A452U285_BCL2A1-      QNGGWSLLPP--------------------------------SASVKGCK
                         :                                                

E2RS00_BCL2A1-01        PKS---GW----LTFLEVLGTVCEMWSHLKQYY-----------------
E2RS00_BCL2A1-02        PKS---GW----LTFLEVLGTVCEMWSHLKQYY-----------------
H0ZCL9_BCL2A1-01        ERR---SL----LSFSKITALFIALVSLFREYY-----------------
U3JTB2_BCL2A1-01        ERR---SL----LSFSKITALFIAVVSLFREYY-----------------
A0A218V8Z6_BCL2A1-      ERR---SL----LSFSRITALFIALVSLFREYY-----------------
Q9W6F2_BCL2A1-01        ERR---SP----LSFSTITDIFAAVLSLFREYH-----------------
A0A493SSZ7_BCL2A1-      ERR---SL----LSFSKITDLFVAVFSLFRE-------------------
G1N8C5_BCL2A1-01        ERR---SP----LSFSTITDIFAAVFSLFRDYY-----------------
A0A452J3N6_BCL2A1-      EKR---SW----LSLFNIKAKIMDAFSFFSQYY-----------------
K7G130_BCL2A1-01        EKQ---SW----LSLFNIKAKIMDAFSFFSQYY-----------------
F7CP56_BCL2A1-02        SKR---------ISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNH
F7CP56_BCL2A1-01        SKR---------ISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNH
F6SFL4_BCL2A1-01        PNT---VW----PNFTDISTKIWGIFSFLK--------------------
G3WSP8_BCL2A1-01        PNM---VW----PNFTDISTKIWNVFSFLK--------------------
A0A2K5PYQ3_BCL2A1-      -------WHSLMLMLVESVAQKKRKMAL----------------------
A0A2K5PYQ3_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYY-----------------
F6S8G3_BCL2A1-01        QKT---VW----SVLADISMKILGVLSHLKQFY-----------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        PKS---GW----LTFLQMTGKIWEMLFLLKQHY-----------------
Q925A9_BCL2A1-01        PKS---GW----LTFLQMTGKIWEMLFLLKQHY-----------------
Q07440_BCL2A1-01        PKS---GW----LTFLQMTGQIWEMLFLLK--------------------
O55179_BCL2A1-01        PKS---GW----LTFLQMTGQIWEMLFLLK--------------------
O55177_BCL2A1-02        PKS---GW----LTFLQMTGQFWEMLFLLK--------------------
Q497M6_BCL2A1-01        PKS---GW----LTFLQMTGQFWEMLFLLK--------------------
Q8K164_BCL2A1-01        PKS---GW----LTFLQMTGQIWEMLFLLK--------------------
Q4FK02_BCL2A1-01        PKS---GW----LTFLQMTGQFWEMLFLLK--------------------
A0A452SIR9_BCL2A1-      PKS---GW----LTFLEVTGKICEMFSLLKQYY-----------------
M3YVH4_BCL2A1-01        PKS---GW----LTFLEVIGKICEMFSLLKQYY-----------------
U6CQS8_BCL2A1-01        PKS---GW----LTFLEVTGKICEMFSLLKQYY-----------------
I3MCZ7_BCL2A1-01        PKS---GW----LTFLGVTGQICEMLSLLKQYY-----------------
G3T8E6_BCL2A1-01        PRS---GW----LTFLEVTGKICEMLFLLKQYY-----------------
H0WZ23_BCL2A1-01        PNSGYSGW----LTFLEVTRKICEMLPLL---------------------
A0A2I3HBP6_BCL2A1-      PKS---GW----MTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANT
A0A2K5D2I1_BCL2A1-      -------W----HSLLLV---LVESVAQKERKMAL---------------
B4E1X9_BCL2A1-01        -------V----MEKFFI---VLSCEIEIENFLAS---------------
A0A2I2YML2_BCL2A1-      -------W----HNHTPM---LVESVAHKKRKMAL---------------
A0A2R8ZJX9_BCL2A1-      -------W----HNHTPM---LVESVAHKKRKMAL---------------
A0A2I3HBP6_BCL2A1-      -------W----HNHMPM---LVESVAHKKRKMAL---------------
A0A2K6PHF2_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6LV19_BCL2A1-      -------W----HNHMPM---LVESVAHRKKKMAL---------------
A0A2K5TMD1_BCL2A1-      -------W----HNHMPM---LVESVAH-KKKMAL---------------
A0A2K5KAA3_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6DS18_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A096NMX5_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6AD27_BCL2A1-      -------W----HNHMPM---LVESVAHRKKKMAL---------------
A0A2K6TLJ5_BCL2A1-      -------S----Q-------------------------------------
F7HXW0_BCL2A1-01        -------W----HSLMLM---LVS-VAQKKRKMAL---------------
A0A2K6TLJ5_BCL2A1-      -------W----NSLMLM---LVE-SAQKKKKMAL---------------
A0A2K6EKG1_BCL2A1-      PRP---AW----LTFLEVTGKICDMLSLL--YS-----------------
A0A452EK63_BCL2A1-      TKS---GW----LTFLEVTGKICETLCRLKQYY-----------------
W5Q0N6_BCL2A1-01        TKS---GW----LTFLEVTGKICETLCRLKQYY-----------------
L8IZT5_BCL2A1-01        TKS---GW----LTFLEVTGKICETLCRLKQYY-----------------
Q3C2I0_BCL2A1-01        TKS---GW----LTFLEVTGKICETLCRLKQYY-----------------
F7CP56_BCL2A1-04        PKS---GW----LTFLEVTGKMCEIL-FLKQYY-----------------
C7F841_BCL2A1-01        PKS---GW----LTFVEVTGKICEMLCLLKQYY-----------------
A0A2K5D2I1_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYY-----------------
H2NNZ9_BCL2A1-01        PKS---GW----MTF-EVTGKICEMLSLLKQYC-----------------
A0A2I2YML2_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K6LV19_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K6PHF2_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K5KHH8_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K5KHH8_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K5KAA3_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K5TMD1_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
F7E8V5_BCL2A1-01        PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K6DS18_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2K6AD27_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A096NMX5_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A0D9RRC3_BCL2A1-      PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
Q16548_BCL2A1-01        PKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
A0A2R8ZJX9_BCL2A1-      HKS---GW----MTFLEVTGKICEMLSLLKQYC-----------------
F7CP56_BCL2A1-03        FNS---NH----MDMVKLASP-EEILSLPKTSWNIHQPGEEEVREEALST
A0A286XUI2_BCL2A1-      PKS---GW----LTFVGVMGQLCEMLSLLKQFY-----------------
A0A452U285_BCL2A1-      PKS---GW----LTFLEVMGKICEMFSLLKQYY-----------------
A0A452U285_BCL2A1-      RRA---PG----RSERRAAATFSAGSSVRE--------------------
                                                                          

E2RS00_BCL2A1-01        --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        MDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGF
F7CP56_BCL2A1-01        MDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTAAWR---------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      YFYFKINNFDDVT-------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        GGLDLILMPGLGFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFK
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        DKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDEND
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        EQICVQVPVDENDMKVDEVLYEDSSAS-----------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        --------------
E2RS00_BCL2A1-02        --------------
H0ZCL9_BCL2A1-01        --------------
U3JTB2_BCL2A1-01        --------------
A0A218V8Z6_BCL2A1-      --------------
Q9W6F2_BCL2A1-01        --------------
A0A493SSZ7_BCL2A1-      --------------
G1N8C5_BCL2A1-01        --------------
A0A452J3N6_BCL2A1-      --------------
K7G130_BCL2A1-01        --------------
F7CP56_BCL2A1-02        MKVDEVLYEDSSAS
F7CP56_BCL2A1-01        --------------
F6SFL4_BCL2A1-01        --------------
G3WSP8_BCL2A1-01        --------------
A0A2K5PYQ3_BCL2A1-      --------------
A0A2K5PYQ3_BCL2A1-      --------------
F6S8G3_BCL2A1-01        --------------
O55178_BCL2A1-01        --------------
Q0P538_BCL2A1-01        --------------
G3V977_BCL2A1-01        --------------
Q925A9_BCL2A1-01        --------------
Q07440_BCL2A1-01        --------------
O55179_BCL2A1-01        --------------
O55177_BCL2A1-02        --------------
Q497M6_BCL2A1-01        --------------
Q8K164_BCL2A1-01        --------------
Q4FK02_BCL2A1-01        --------------
A0A452SIR9_BCL2A1-      --------------
M3YVH4_BCL2A1-01        --------------
U6CQS8_BCL2A1-01        --------------
I3MCZ7_BCL2A1-01        --------------
G3T8E6_BCL2A1-01        --------------
H0WZ23_BCL2A1-01        --------------
A0A2I3HBP6_BCL2A1-      --------------
A0A2K5D2I1_BCL2A1-      --------------
B4E1X9_BCL2A1-01        --------------
A0A2I2YML2_BCL2A1-      --------------
A0A2R8ZJX9_BCL2A1-      --------------
A0A2I3HBP6_BCL2A1-      --------------
A0A2K6PHF2_BCL2A1-      --------------
A0A2K6LV19_BCL2A1-      --------------
A0A2K5TMD1_BCL2A1-      --------------
A0A2K5KAA3_BCL2A1-      --------------
A0A2K6DS18_BCL2A1-      --------------
A0A096NMX5_BCL2A1-      --------------
A0A2K6AD27_BCL2A1-      --------------
A0A2K6TLJ5_BCL2A1-      --------------
F7HXW0_BCL2A1-01        --------------
A0A2K6TLJ5_BCL2A1-      --------------
A0A2K6EKG1_BCL2A1-      --------------
A0A452EK63_BCL2A1-      --------------
W5Q0N6_BCL2A1-01        --------------
L8IZT5_BCL2A1-01        --------------
Q3C2I0_BCL2A1-01        --------------
F7CP56_BCL2A1-04        --------------
C7F841_BCL2A1-01        --------------
A0A2K5D2I1_BCL2A1-      --------------
H2NNZ9_BCL2A1-01        --------------
A0A2I2YML2_BCL2A1-      --------------
A0A2K6LV19_BCL2A1-      --------------
A0A2K6PHF2_BCL2A1-      --------------
A0A2K5KHH8_BCL2A1-      --------------
A0A2K5KHH8_BCL2A1-      --------------
A0A2K5KAA3_BCL2A1-      --------------
A0A2K5TMD1_BCL2A1-      --------------
F7E8V5_BCL2A1-01        --------------
A0A2K6DS18_BCL2A1-      --------------
A0A2K6AD27_BCL2A1-      --------------
A0A096NMX5_BCL2A1-      --------------
A0A0D9RRC3_BCL2A1-      --------------
Q16548_BCL2A1-01        --------------
A0A2R8ZJX9_BCL2A1-      --------------
F7CP56_BCL2A1-03        --------------
A0A286XUI2_BCL2A1-      --------------
A0A452U285_BCL2A1-      --------------
A0A452U285_BCL2A1-      --------------
                                      

© 1998-2020Legal notice