Dataset for protein Bfl1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

79 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E2RS00_BCL2A1-01        MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPG
A0A3L7HT14_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        PQGLPGTLMTNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDL
A0A3L7HT14_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        PAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPW
A0A3L7HT14_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-02        ---------------------------MSHLFGGSYDAQRCSGERRLPAV
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        ESGRSKPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
A0A3L7HT14_BCL2A1-      ------------------------------------MITPSLSSHLWLSC
E2RS00_BCL2A1-02        GFMFLWPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------MITPSLSSHLWLSCLFDW
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      ------------------------MGHILLSATAGSLDLREPAAGCCL--
A0A452U285_BCL2A1-      ------------------------MHTEIPPASARPMSHRPSPAGARLIW
A0A452U285_BCL2A1-      ------------------------MHTEIPPASARPMSHRPSPAGARLIW
                                                                          

E2RS00_BCL2A1-01        SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
A0A3L7HT14_BCL2A1-      LFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSR
E2RS00_BCL2A1-02        SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ---------------MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
H0ZCL9_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
U3JTB2_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
A0A218V8Z6_BCL2A1-      ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
Q9W6F2_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
A0A493SSZ7_BCL2A1-      ---------------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH
G1N8C5_BCL2A1-01        ---------------METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAH
A0A452J3N6_BCL2A1-      ---------------MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAH
K7G130_BCL2A1-01        ---------------MESSEFRYVYYLVQDYLKYILQEPELGPAPSRVAH
A0A2K5PYQ3_BCL2A1-      ---------------MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSR
A0A2K5PYQ3_BCL2A1-      ---------------MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSR
F6SFL4_BCL2A1-01        ---------------MDDYEFHYVHMLARDYLKHVQQTPPLGSCLNKTSQ
G3WSP8_BCL2A1-01        ---------------MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQ
F6S8G3_BCL2A1-01        ---------------MDDGVFWSVRALALDYLDDVLQTPRLGTVPSRTSR
O55178_BCL2A1-01        ---------------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFR
Q0P538_BCL2A1-01        ---------------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFR
G3V977_BCL2A1-01        ---------------MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSR
Q925A9_BCL2A1-01        ---------------MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSR
Q07440_BCL2A1-01        ---------------MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACR
O55179_BCL2A1-01        ---------------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
O55177_BCL2A1-02        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
Q497M6_BCL2A1-01        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACR
Q8K164_BCL2A1-01        ---------------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACR
Q4FK02_BCL2A1-01        ---------------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACR
A0A452SIR9_BCL2A1-      ---------------MTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
M3YVH4_BCL2A1-01        ---------------MTDSEFGYTLSLAQDYVRHVLQIPQPSPAASRVSR
U6CQS8_BCL2A1-01        ---------------MTDGEFGYTLSLAQDYVRHVLQIPQPGPAASRVSR
I3MCZ7_BCL2A1-01        ---------------MNDCEFRFIHTLAQDYLQHVLQVPQRGSSPSKTSK
G3T8E6_BCL2A1-01        ---------------MTDCEFGYIYKLVQDYLKYVLQIPQPAAGSSKTSR
H0WZ23_BCL2A1-01        ---------------MTDCEFGYIHRLAQDYLQYVLQIQQCGSGPSKTSR
A0A2K6TLJ5_BCL2A1-      ---------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
A0A2K5D2I1_BCL2A1-      ---------------MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
B4E1X9_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSR
A0A2I2YML2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2R8ZJX9_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSR
A0A2I3HBP6_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6PHF2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6LV19_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5TMD1_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KAA3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6DS18_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A096NMX5_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSR
A0A2K6AD27_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
F7HXW0_BCL2A1-01        ---------------MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSR
A0A2K6TLJ5_BCL2A1-      ---------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
A0A2I3HBP6_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6EKG1_BCL2A1-      ---------------MTDCEFGYTHRLVQDYLQYVLRVPQPGSGPSKTSR
A0A452EK63_BCL2A1-      ---------------MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSR
W5Q0N6_BCL2A1-01        ---------------MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSR
L8IZT5_BCL2A1-01        ---------------MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISR
Q3C2I0_BCL2A1-01        ---------------MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSR
F7CP56_BCL2A1-04        ---------------MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
C7F841_BCL2A1-01        ---------------MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSR
A0A2K5D2I1_BCL2A1-      ---------------MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSR
H2NNZ9_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKASR
A0A2I2YML2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6LV19_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6PHF2_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KHH8_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KHH8_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5KAA3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K5TMD1_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
F7E8V5_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6DS18_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A2K6AD27_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
A0A096NMX5_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSR
A0A0D9RRC3_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSR
Q16548_BCL2A1-01        ---------------MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSR
A0A2R8ZJX9_BCL2A1-      ---------------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSR
A0A3L7HT14_BCL2A1-      TWQLQSAL----PRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSR
F7CP56_BCL2A1-03        ---------------MTDC-------------------------------
A0A286XUI2_BCL2A1-      ------------PPRMIDLEFRYTQALAQDYLLHVLQVPQCETSPSKASK
A0A452U285_BCL2A1-      PXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
A0A452U285_BCL2A1-      PXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQ
                                                                          

E2RS00_BCL2A1-01        VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
A0A3L7HT14_BCL2A1-      VLQRVASSVQKEVEKNLKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIIN
E2RS00_BCL2A1-02        VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
A0A3L7HT14_BCL2A1-      -----------------------MACAPMLVHRGHAPSLPTASEGDGRGR
F7CP56_BCL2A1-02        ---------------------------------------MEKQFEDGIIN
F7CP56_BCL2A1-01        VLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIIN
H0ZCL9_BCL2A1-01        VLRTMASSLQDQTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFADGNTN
U3JTB2_BCL2A1-01        VLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTN
A0A218V8Z6_BCL2A1-      VLRTMASSLQDQTEEAVRPLLDRIDISSVAVAKRIFNGVMDEKFADGNTN
Q9W6F2_BCL2A1-01        VLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTN
A0A493SSZ7_BCL2A1-      VLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFADGNTN
G1N8C5_BCL2A1-01        VLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTN
A0A452J3N6_BCL2A1-      VLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFADGNTN
K7G130_BCL2A1-01        VLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFDDGNTN
A0A2K5PYQ3_BCL2A1-      VLQKVAFSVQ-------KPCLDNVNIVSIDNARTIFSQVMETEFEDGIIN
A0A2K5PYQ3_BCL2A1-      VLQKVAFSVQ-------KPCLDNVNIVSIDNARTIFSQVMETEFEDGIIN
F6SFL4_BCL2A1-01        ILQKVAFSVQQEVEKDMETCLSTLDIVSVESARRIFNSVMKKEFEDGVIN
G3WSP8_BCL2A1-01        ILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFEDGIIN
F6S8G3_BCL2A1-01        ALQNVMFSVQGDVEKALKPCFDSLDVGSVGAARRIFGQIVEKEFEDGIVN
O55178_BCL2A1-01        VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFEDGIIN
Q0P538_BCL2A1-01        VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGIIN
G3V977_BCL2A1-01        VLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q925A9_BCL2A1-01        VLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q07440_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
O55179_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
O55177_BCL2A1-02        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q497M6_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q8K164_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
Q4FK02_BCL2A1-01        VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIIN
A0A452SIR9_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
M3YVH4_BCL2A1-01        VLRDVASSVQGEVEQNLRPCLDSFDVGSIDTARTIFNQVMEKEFEDGIIN
U6CQS8_BCL2A1-01        VLRDVASSVQREVEQNLKPCLDSFDVGSIDTARTIFNQVMEKEFEDGIIN
I3MCZ7_BCL2A1-01        VLQNVAFSVQKEVEKNLKPFLDNFDVVSADTARTIFNQVMEKEFEDGIMN
G3T8E6_BCL2A1-01        VLQNVAFSVQKEVEKNLKPCLDNFVVISIDTAQTIFKQVMEKEFEDGIIN
H0WZ23_BCL2A1-01        VLQNVAFSVQEEVEKSLKPCLDNFNVVSIDTARTIFNQVMEKEFEDGIIN
A0A2K6TLJ5_BCL2A1-      VLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIIN
A0A2K5D2I1_BCL2A1-      VLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFEDGIIN
B4E1X9_BCL2A1-01        VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I2YML2_BCL2A1-      VLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2R8ZJX9_BCL2A1-      VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I3HBP6_BCL2A1-      VLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K6PHF2_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6LV19_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5TMD1_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KAA3_BCL2A1-      VLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIIN
A0A2K6DS18_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A096NMX5_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6AD27_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
F7HXW0_BCL2A1-01        VLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFEDGIIN
A0A2K6TLJ5_BCL2A1-      VLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIIN
A0A2I3HBP6_BCL2A1-      VLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K6EKG1_BCL2A1-      VLQNIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFEDGIVN
A0A452EK63_BCL2A1-      VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
W5Q0N6_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
L8IZT5_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
Q3C2I0_BCL2A1-01        VLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVN
F7CP56_BCL2A1-04        VLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIIN
C7F841_BCL2A1-01        VLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIIN
A0A2K5D2I1_BCL2A1-      VLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFEDGIIN
H2NNZ9_BCL2A1-01        VLQKVAFSVQKEVEKNLKPCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2I2YML2_BCL2A1-      VLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIIN
A0A2K6LV19_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6PHF2_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KHH8_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KHH8_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K5KAA3_BCL2A1-      VLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIIN
A0A2K5TMD1_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
F7E8V5_BCL2A1-01        VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6DS18_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A2K6AD27_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A096NMX5_BCL2A1-      VLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
A0A0D9RRC3_BCL2A1-      VLQKVASSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIIN
Q16548_BCL2A1-01        VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A2R8ZJX9_BCL2A1-      VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIIN
A0A3L7HT14_BCL2A1-      VLQRVASSVQKEVEKNLKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIIN
F7CP56_BCL2A1-03        --------------------------------------------------
A0A286XUI2_BCL2A1-      VLQDMALSVQEEVERRLKPWLDRIDVESIDTAKSIFNQVMEKEFEDGIIN
A0A452U285_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
A0A452U285_BCL2A1-      VLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIIN
                                                                          

E2RS00_BCL2A1-01        WGRIVTVFAFEGILTKKLLEQRISSDVDA-EKVSYFVAEFITRNMRDWIR
A0A3L7HT14_BCL2A1-      WGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTAEWIR
E2RS00_BCL2A1-02        WGRIVTVFAFEGILTKKLLEQRISSDVDA-EKVSYFVAEFITRNMRDWIR
A0A3L7HT14_BCL2A1-      GGTCHVMAAVAASSAKRSLRAELKQRLRALSAEERLRQSHLLTQK-----
F7CP56_BCL2A1-02        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
F7CP56_BCL2A1-01        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
H0ZCL9_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWID
U3JTB2_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWID
A0A218V8Z6_BCL2A1-      WGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWID
Q9W6F2_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISYFITEYIINNKAAWID
A0A493SSZ7_BCL2A1-      WGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWID
G1N8C5_BCL2A1-01        WGRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWID
A0A452J3N6_BCL2A1-      WGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIE
K7G130_BCL2A1-01        WGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWID
A0A2K5PYQ3_BCL2A1-      WGRIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIR
A0A2K5PYQ3_BCL2A1-      WGRIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIR
F6SFL4_BCL2A1-01        WGRIVTIFAFGGILIKKLLRHRAPLTMGTQEEISHFIAEFIMNNIAEWIR
G3WSP8_BCL2A1-01        WGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIR
F6S8G3_BCL2A1-01        WGRIVTIFVLGGILTKKLQRSGVPLTRETREEISCFIAEFTTHHAGEWIR
O55178_BCL2A1-01        WGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQF-----------WGR
Q0P538_BCL2A1-01        WGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQF-----------WGR
G3V977_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQ
Q925A9_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQ
Q07440_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIR
O55179_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIR
O55177_BCL2A1-02        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q497M6_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q8K164_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
Q4FK02_BCL2A1-01        WGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIR
A0A452SIR9_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
M3YVH4_BCL2A1-01        WGRIVTVFAFEGILSKKLLRERISPDVDASR-VSYFVAEFITTNMREWIR
U6CQS8_BCL2A1-01        WGRIVTVFAFEGILSKKLLRERISPDVDASR-VSYFVAEFITTNMREWIR
I3MCZ7_BCL2A1-01        WGRIVTIFAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIR
G3T8E6_BCL2A1-01        WGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWIR
H0WZ23_BCL2A1-01        WGRIVTIFAFGGILLKKLLQQRIALDVDTYKEISYFVAEFIMNYTGEWIR
A0A2K6TLJ5_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIS
B4E1X9_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2I3HBP6_BCL2A1-      WGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6PHF2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6LV19_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5TMD1_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KAA3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6DS18_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6AD27_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
F7HXW0_BCL2A1-01        WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIR
A0A2K6TLJ5_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2I3HBP6_BCL2A1-      WGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6EKG1_BCL2A1-      WGRIVTVFAFGGILIKKLLREQIALDVDTYKEISYFIAEFITNNAGEWIR
A0A452EK63_BCL2A1-      WGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIR
W5Q0N6_BCL2A1-01        WGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITKNTGEWIR
L8IZT5_BCL2A1-01        WGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIK
Q3C2I0_BCL2A1-01        WGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIK
F7CP56_BCL2A1-04        WGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
C7F841_BCL2A1-01        WGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIR
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIS
H2NNZ9_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFVMNNTGGWIK
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6LV19_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6PHF2_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KHH8_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KHH8_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5KAA3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K5TMD1_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
F7E8V5_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6DS18_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2K6AD27_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A0D9RRC3_BCL2A1-      WGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFITNNTGEWIR
Q16548_BCL2A1-01        WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
A0A3L7HT14_BCL2A1-      WGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTAEWIR
F7CP56_BCL2A1-03        ------------ILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
A0A286XUI2_BCL2A1-      WGRIVTIFAFGGVILKKLPREPIAPDVDTYKEISYFVAEFIMSRMGGWIR
A0A452U285_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
A0A452U285_BCL2A1-      WGRIVTIFAFEGILTKKLLQERISPDVDASR-ISYFVAEFITTNMREWIR
                                       *.                  :              

E2RS00_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
A0A3L7HT14_BCL2A1-      QNGGWVIAHSQYQNSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYR
E2RS00_BCL2A1-02        QNGGW------------------------------------ENGFVKKFE
A0A3L7HT14_BCL2A1-      -----VIAHSQYQNSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYR
F7CP56_BCL2A1-02        QNGGWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQ
F7CP56_BCL2A1-01        QNGGWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQ
H0ZCL9_BCL2A1-01        ANGGW------------------------------------ENGFLTKF-
U3JTB2_BCL2A1-01        ANGGW------------------------------------ENGFLTKF-
A0A218V8Z6_BCL2A1-      ANGGW------------------------------------ENGFLTKF-
Q9W6F2_BCL2A1-01        ANGGW------------------------------------ENGFLTKF-
A0A493SSZ7_BCL2A1-      ANGGW------------------------------------ENGFLTKF-
G1N8C5_BCL2A1-01        ANGGW------------------------------------ENGFLTKF-
A0A452J3N6_BCL2A1-      ANGGW------------------------------------ENGFLTMFE
K7G130_BCL2A1-01        ANGGW------------------------------------ENGFLPMFE
A0A2K5PYQ3_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K5PYQ3_BCL2A1-      QNGGW------------------------------------GK-------
F6SFL4_BCL2A1-01        QNGGW------------------------------------ENGFVKNFE
G3WSP8_BCL2A1-01        QNGGW------------------------------------ENGFIKNFE
F6S8G3_BCL2A1-01        QNGGW------------------------------------ENGFLNKFE
O55178_BCL2A1-01        IHNE----------------------------------------------
Q0P538_BCL2A1-01        IHHE----------------------------------------------
G3V977_BCL2A1-01        QNGGW------------------------------------EDGFTKKFE
Q925A9_BCL2A1-01        QNGGW------------------------------------EDGFTKKFE
Q07440_BCL2A1-01        QNGGW------------------------------------EDGFIKKFE
O55179_BCL2A1-01        RNGGW------------------------------------EDGFIKKFE
O55177_BCL2A1-02        RNGGW------------------------------------EDGFIKKFE
Q497M6_BCL2A1-01        RNGGW------------------------------------EDGFIKKFE
Q8K164_BCL2A1-01        RNGGW------------------------------------EDGFIKKFE
Q4FK02_BCL2A1-01        RNGGW------------------------------------EDGFIKKFE
A0A452SIR9_BCL2A1-      QNGGW------------------------------------EDGFVKKFE
M3YVH4_BCL2A1-01        QNGGW------------------------------------EDGFVKKFE
U6CQS8_BCL2A1-01        QNGGW------------------------------------EDGFVKKFE
I3MCZ7_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
G3T8E6_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
H0WZ23_BCL2A1-01        QNGGW------------------------------------EHGFVKKFE
A0A2K6TLJ5_BCL2A1-      RNGGW------------------------------------DLSQ-----
A0A2K5D2I1_BCL2A1-      QNGGW------------------------------------AK-------
B4E1X9_BCL2A1-01        QNGGW------------------------------------VC-------
A0A2I2YML2_BCL2A1-      QNGGW------------------------------------GK-------
A0A2R8ZJX9_BCL2A1-      QNGGW------------------------------------GK-------
A0A2I3HBP6_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K6PHF2_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K6LV19_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K5TMD1_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K5KAA3_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K6DS18_BCL2A1-      QNGGW------------------------------------GK-------
A0A096NMX5_BCL2A1-      QNGGW------------------------------------GK-------
A0A2K6AD27_BCL2A1-      QNGGW------------------------------------GK-------
F7HXW0_BCL2A1-01        QNGGW------------------------------------GK-------
A0A2K6TLJ5_BCL2A1-      RNGGW------------------------------------GK-------
A0A2I3HBP6_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K6EKG1_BCL2A1-      QNGGW------------------------------------EHGFVKKFE
A0A452EK63_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
W5Q0N6_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
L8IZT5_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
Q3C2I0_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
F7CP56_BCL2A1-04        QNGGW------------------------------------ENGFVKKFE
C7F841_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
A0A2K5D2I1_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
H2NNZ9_BCL2A1-01        QNGGW------------------------------------ENGFVKKLE
A0A2I2YML2_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K6LV19_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K6PHF2_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K5KHH8_BCL2A1-      QNGGW------------------------------------ENGFVKKLE
A0A2K5KHH8_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K5KAA3_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K5TMD1_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
F7E8V5_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
A0A2K6DS18_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A2K6AD27_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A096NMX5_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A0D9RRC3_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
Q16548_BCL2A1-01        QNGGW------------------------------------ENGFVKKFE
A0A2R8ZJX9_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A3L7HT14_BCL2A1-      QNGGWE------------------------------------DGFMKKFE
F7CP56_BCL2A1-03        QNGGWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQ
A0A286XUI2_BCL2A1-      QNGGWD------------------------------------NGFVRKFE
A0A452U285_BCL2A1-      QNGGWE------------------------------------DGFVKKFE
A0A452U285_BCL2A1-      QNGGWSLLPP--------------------------------SASVKGCK
                                                                          

E2RS00_BCL2A1-01        PK---SGW----LTFLEVLGTVCEMWSHLKQYY-----------------
A0A3L7HT14_BCL2A1-      FQ---SNH----MDMVRLASP-EEISLLPKTSWNIHQPAEGDAREEALST
E2RS00_BCL2A1-02        PK---SGW----LTFLEVLGTVCEMWSHLKQYY-----------------
A0A3L7HT14_BCL2A1-      FQ---SNH----MDMVRLASP-EEISLLPKTSWNIHQPAEGDAREEALST
F7CP56_BCL2A1-02        FN---SNH----MDMVKLASP-EEILSLPKTSWNIHQPGEEEVREEALST
F7CP56_BCL2A1-01        FN---SNH----MDMVKLASP-EEILSLPKTSWNIHQPGEEEVREEALST
H0ZCL9_BCL2A1-01        ER---RSL----LSFSKITALFIALVSLFREYY-----------------
U3JTB2_BCL2A1-01        ER---RSL----LSFSKITALFIAVVSLFREYY-----------------
A0A218V8Z6_BCL2A1-      ER---RSL----LSFSRITALFIALVSLFREYY-----------------
Q9W6F2_BCL2A1-01        ER---RSP----LSFSTITDIFAAVLSLFREYH-----------------
A0A493SSZ7_BCL2A1-      ER---RSL----LSFSKITDLFVAVFSLFRE-------------------
G1N8C5_BCL2A1-01        ER---RSP----LSFSTITDIFAAVFSLFRDYY-----------------
A0A452J3N6_BCL2A1-      EK---RSW----LSLFNIKAKIMDAFSFFSQYY-----------------
K7G130_BCL2A1-01        EK---QSW----LSLFNIKAKIMDAFSFFSQYY-----------------
A0A2K5PYQ3_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQYY-----------------
A0A2K5PYQ3_BCL2A1-      -------WHSLMLMLVESVAQKKRKMAL----------------------
F6SFL4_BCL2A1-01        PN---TVW----PNFTDISTKIWGIFSFLK--------------------
G3WSP8_BCL2A1-01        PN---MVW----PNFTDISTKIWNVFSFLK--------------------
F6S8G3_BCL2A1-01        QK---TVW----SVLADISMKILGVLSHLKQFY-----------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        PK---SGW----LTFLQMTGKIWEMLFLLKQHY-----------------
Q925A9_BCL2A1-01        PK---SGW----LTFLQMTGKIWEMLFLLKQHY-----------------
Q07440_BCL2A1-01        PK---SGW----LTFLQMTGQIWEMLFLLK--------------------
O55179_BCL2A1-01        PK---SGW----LTFLQMTGQIWEMLFLLK--------------------
O55177_BCL2A1-02        PK---SGW----LTFLQMTGQFWEMLFLLK--------------------
Q497M6_BCL2A1-01        PK---SGW----LTFLQMTGQFWEMLFLLK--------------------
Q8K164_BCL2A1-01        PK---SGW----LTFLQMTGQIWEMLFLLK--------------------
Q4FK02_BCL2A1-01        PK---SGW----LTFLQMTGQFWEMLFLLK--------------------
A0A452SIR9_BCL2A1-      PK---SGW----LTFLEVTGKICEMFSLLKQYY-----------------
M3YVH4_BCL2A1-01        PK---SGW----LTFLEVIGKICEMFSLLKQYY-----------------
U6CQS8_BCL2A1-01        PK---SGW----LTFLEVTGKICEMFSLLKQYY-----------------
I3MCZ7_BCL2A1-01        PK---SGW----LTFLGVTGQICEMLSLLKQYY-----------------
G3T8E6_BCL2A1-01        PR---SGW----LTFLEVTGKICEMLFLLKQYY-----------------
H0WZ23_BCL2A1-01        PNSGYSGW----LTFLEVTRKICEMLPLL---------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      -------W----HSLLLV---LVESVAQKERKMAL---------------
B4E1X9_BCL2A1-01        -------V----MEKFFI---VLSCEIEIENFLAS---------------
A0A2I2YML2_BCL2A1-      -------W----HNHTPM---LVESVAHKKRKMAL---------------
A0A2R8ZJX9_BCL2A1-      -------W----HNHTPM---LVESVAHKKRKMAL---------------
A0A2I3HBP6_BCL2A1-      -------W----HNHMPM---LVESVAHKKRKMAL---------------
A0A2K6PHF2_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6LV19_BCL2A1-      -------W----HNHMPM---LVESVAHRKKKMAL---------------
A0A2K5TMD1_BCL2A1-      -------W----HNHMPM---LVESVAH-KKKMAL---------------
A0A2K5KAA3_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6DS18_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A096NMX5_BCL2A1-      -------W----HNHMPM---LVESVAHKKKKMAL---------------
A0A2K6AD27_BCL2A1-      -------W----HNHMPM---LVESVAHRKKKMAL---------------
F7HXW0_BCL2A1-01        -------W----HSLMLM---LVS-VAQKKRKMAL---------------
A0A2K6TLJ5_BCL2A1-      -------W----NSLMLM---LVE-SAQKKKKMAL---------------
A0A2I3HBP6_BCL2A1-      PK---SGW----MTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANT
A0A2K6EKG1_BCL2A1-      PR---PAW----LTFLEVTGKICDMLSLL---YS----------------
A0A452EK63_BCL2A1-      TK---SGW----LTFLEVTGKICETLCRLKQ-YY----------------
W5Q0N6_BCL2A1-01        TK---SGW----LTFLEVTGKICETLCRLKQ-YY----------------
L8IZT5_BCL2A1-01        TK---SGW----LTFLEVTGKICETLCRLKQ-YY----------------
Q3C2I0_BCL2A1-01        TK---SGW----LTFLEVTGKICETLCRLKQ-YY----------------
F7CP56_BCL2A1-04        PK---SGW----LTFLEVTGKMCEIL-FLKQ-YY----------------
C7F841_BCL2A1-01        PK---SGW----LTFVEVTGKICEMLCLLKQ-YY----------------
A0A2K5D2I1_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YY----------------
H2NNZ9_BCL2A1-01        PK---SGW----MTF-EVTGKICEMLSLLKQ-YC----------------
A0A2I2YML2_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K6LV19_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K6PHF2_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K5KHH8_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K5KHH8_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K5KAA3_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K5TMD1_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
F7E8V5_BCL2A1-01        PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K6DS18_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2K6AD27_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A096NMX5_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A0D9RRC3_BCL2A1-      PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
Q16548_BCL2A1-01        PK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A2R8ZJX9_BCL2A1-      HK---SGW----MTFLEVTGKICEMLSLLKQ-YC----------------
A0A3L7HT14_BCL2A1-      PK---SGW----VTFLETIGQIWEMLFSPQATLLAREDPGSFDNGDHHLV
F7CP56_BCL2A1-03        FN---SNH----MDMVKLASP-EEILSLPKTSWNIHQPGEEEVREEALST
A0A286XUI2_BCL2A1-      PK---SGW----LTFVGVMGQLCEMLSLLKQFY-----------------
A0A452U285_BCL2A1-      PK---SGW----LTFLEVMGKICEMFSLLKQYY-----------------
A0A452U285_BCL2A1-      RR---APG----RSERRAAATFSAGSSVRE--------------------
                                                                          

E2RS00_BCL2A1-01        --------------------------------------------------
A0A3L7HT14_BCL2A1-      GGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFK
E2RS00_BCL2A1-02        --------------------------------------------------
A0A3L7HT14_BCL2A1-      GGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFK
F7CP56_BCL2A1-02        GGLDLILMPGLGFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFK
F7CP56_BCL2A1-01        AAWR----------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      YFYFKINNFDDVT-------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      LPFANNSADRT---------------------------------------
F7CP56_BCL2A1-03        GGLDLILMPGLGFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFK
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

E2RS00_BCL2A1-01        ---------------------------
A0A3L7HT14_BCL2A1-      EQICPQVPVDEHDMKVDEVLYEDCPAS
E2RS00_BCL2A1-02        ---------------------------
A0A3L7HT14_BCL2A1-      EQICPQVPVDEHDMKVDEVLYEDCPAS
F7CP56_BCL2A1-02        EQICVQVPVDENDMKVDEVLYEDSSAS
F7CP56_BCL2A1-01        ---------------------------
H0ZCL9_BCL2A1-01        ---------------------------
U3JTB2_BCL2A1-01        ---------------------------
A0A218V8Z6_BCL2A1-      ---------------------------
Q9W6F2_BCL2A1-01        ---------------------------
A0A493SSZ7_BCL2A1-      ---------------------------
G1N8C5_BCL2A1-01        ---------------------------
A0A452J3N6_BCL2A1-      ---------------------------
K7G130_BCL2A1-01        ---------------------------
A0A2K5PYQ3_BCL2A1-      ---------------------------
A0A2K5PYQ3_BCL2A1-      ---------------------------
F6SFL4_BCL2A1-01        ---------------------------
G3WSP8_BCL2A1-01        ---------------------------
F6S8G3_BCL2A1-01        ---------------------------
O55178_BCL2A1-01        ---------------------------
Q0P538_BCL2A1-01        ---------------------------
G3V977_BCL2A1-01        ---------------------------
Q925A9_BCL2A1-01        ---------------------------
Q07440_BCL2A1-01        ---------------------------
O55179_BCL2A1-01        ---------------------------
O55177_BCL2A1-02        ---------------------------
Q497M6_BCL2A1-01        ---------------------------
Q8K164_BCL2A1-01        ---------------------------
Q4FK02_BCL2A1-01        ---------------------------
A0A452SIR9_BCL2A1-      ---------------------------
M3YVH4_BCL2A1-01        ---------------------------
U6CQS8_BCL2A1-01        ---------------------------
I3MCZ7_BCL2A1-01        ---------------------------
G3T8E6_BCL2A1-01        ---------------------------
H0WZ23_BCL2A1-01        ---------------------------
A0A2K6TLJ5_BCL2A1-      ---------------------------
A0A2K5D2I1_BCL2A1-      ---------------------------
B4E1X9_BCL2A1-01        ---------------------------
A0A2I2YML2_BCL2A1-      ---------------------------
A0A2R8ZJX9_BCL2A1-      ---------------------------
A0A2I3HBP6_BCL2A1-      ---------------------------
A0A2K6PHF2_BCL2A1-      ---------------------------
A0A2K6LV19_BCL2A1-      ---------------------------
A0A2K5TMD1_BCL2A1-      ---------------------------
A0A2K5KAA3_BCL2A1-      ---------------------------
A0A2K6DS18_BCL2A1-      ---------------------------
A0A096NMX5_BCL2A1-      ---------------------------
A0A2K6AD27_BCL2A1-      ---------------------------
F7HXW0_BCL2A1-01        ---------------------------
A0A2K6TLJ5_BCL2A1-      ---------------------------
A0A2I3HBP6_BCL2A1-      ---------------------------
A0A2K6EKG1_BCL2A1-      ---------------------------
A0A452EK63_BCL2A1-      ---------------------------
W5Q0N6_BCL2A1-01        ---------------------------
L8IZT5_BCL2A1-01        ---------------------------
Q3C2I0_BCL2A1-01        ---------------------------
F7CP56_BCL2A1-04        ---------------------------
C7F841_BCL2A1-01        ---------------------------
A0A2K5D2I1_BCL2A1-      ---------------------------
H2NNZ9_BCL2A1-01        ---------------------------
A0A2I2YML2_BCL2A1-      ---------------------------
A0A2K6LV19_BCL2A1-      ---------------------------
A0A2K6PHF2_BCL2A1-      ---------------------------
A0A2K5KHH8_BCL2A1-      ---------------------------
A0A2K5KHH8_BCL2A1-      ---------------------------
A0A2K5KAA3_BCL2A1-      ---------------------------
A0A2K5TMD1_BCL2A1-      ---------------------------
F7E8V5_BCL2A1-01        ---------------------------
A0A2K6DS18_BCL2A1-      ---------------------------
A0A2K6AD27_BCL2A1-      ---------------------------
A0A096NMX5_BCL2A1-      ---------------------------
A0A0D9RRC3_BCL2A1-      ---------------------------
Q16548_BCL2A1-01        ---------------------------
A0A2R8ZJX9_BCL2A1-      ---------------------------
A0A3L7HT14_BCL2A1-      ---------------------------
F7CP56_BCL2A1-03        EQICVQVPVDENDMKVDEVLYEDSSAS
A0A286XUI2_BCL2A1-      ---------------------------
A0A452U285_BCL2A1-      ---------------------------
A0A452U285_BCL2A1-      ---------------------------
                                                   

© 1998-2020Legal notice