Dataset for protein Bcl-w of organism Vulpes vulpes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** . :.                     ***                        **    :*:::.  .: .:::. ::
MAtpasapdtralvadfvgyklrqkgyvCGAgpgegpaadplhqamraagdefetRFrrtfsDlaaqlhvtpgsaqqrft
  gslavr--------------------   ------------------------  tchet vsssnltsqsaseraia

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .*      :*  *:*                    :.. *.  * *   **          ****************
qvsdElfqggpnWgrLvAffvfgaalcaesvnkemeplvgqvQewmVaYletRLadwihssggwELEAIKARVREMEEEA
arrs ------d pf l --------------------lasg sps i sri  e---------                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
                                                                                

       330   
....:....|...
*************
RGRARATSWYSPY
             
© 1998-2020Legal notice