Dataset for protein Bcl-w of organism Vulpes vulpes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q7T511_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A3Q7T511_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A3Q7T511_BCL2L2-      MAGSLAVR--------------------CGA-------------------
                        ** . :.                     ***                   

A0A3Q7T511_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A3Q7T511_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A3Q7T511_BCL2L2-      -----RFTCHETDVSSSNLTSQSASERAIAARRSE------DWPFLLA--
                             **    :*:::.  .: .:::. ::   .*      :*  *:*  

A0A3Q7T511_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
A0A3Q7T511_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
A0A3Q7T511_BCL2L2-      ------------------LASGQSPSVIYSRIRLE---------ELEAIK
                                          :.. *.  * *   **          ******

A0A3Q7T511_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A3Q7T511_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A3Q7T511_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
                        **************************************************

A0A3Q7T511_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A3Q7T511_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A3Q7T511_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
                        **************************************************

A0A3Q7T511_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A3Q7T511_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A3Q7T511_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
                        **************************************************

A0A3Q7T511_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A3Q7T511_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A3Q7T511_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                        *********************************

© 1998-2020Legal notice