Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------matpasapdtraLvadfvgyklr-----qkgyvcgagpgegpaadplhqa------
mfglqrnaviglnlycggaglgpgsgss----gg-l-atgylatarqevggg---------t-as-pst-apdvrrvarp
                        -m-ddmsq--h- ---ke-----     ea msispsad--q--rv--e-teseae
                         -a- frgynar lv --savps         iwqgf-avrktr-ker-t      
                             efesi m  q akk cmm          peq s seen se lag      
                                r  e      e  a               g p a     a        
                                          d                                     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spigaegpdvtatparllffaptrlasppeemespasdaimspeeeldgyepeplgkrpavlpllglveeassgpgtdgs
t sain npswhladspavnga ghs sldar vipma vkqa                                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    :.       .  
-----------------------------------------------------mraagdefetrfrrtfsdlaaqlhvtp
lpstpppaeeeedelyrqsleiisrylreqatgakdakpmggsgaasrkaletl-rv--gvqrnhetalqgmlrk-dikn
                                                     -f--qn--------c dvytv- -fsw
                                                     a s aaqirlyyvp   nfrs    ri
                                                       e      k nk      dg      
                                                       c      e l               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .          ** *:.::: * . :                :       .   :          *:  . 
gsaqqrftqVsdelfqgG-pNWGRlVaffvFgaalcaesvnk---------emeplvgqvqewmvtyLetrladWihssg
eddvkslsramvhvlsdrvt  y iatlis egfvakhlksiacgrkkpevnqyscieplaasitdvnvrtkr- lvkqr
ntvylvawm qnlearp iv    v silt a m mvrhpre    iakdgdvsvecsyivtlliaq tgq--t  rqna
dr rii n  lkk  e  gi         a   i lek ld           tqrd rrfp efc k sshhep  qe  
   e   e   e                                          k   l     a   nd      la  
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                                                                               
GWd-----------------------------------------------------------------------------
speleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgc
  a                                                                             
  r                                                                             
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------gfveffhvedle------------------------pgirtvllgfvrvrgvvrglayls
gsvnrvtilcdkfsghpkgfayialsgkgsvrtslaldeslwrgrqikvipkrtnrgsvsstdtavpgagyrgattnfni
                    e-t--ydnsatqearrgr gnf              a--knnwrtaaalaala--gl-fa
                    -l-ns--dnpqkk  k q rfn              -trhwgkvfm---t---tv--w--
                    t ml  qgalaga                       wep mf ic tyc-vkrwssscsw
                    s c   ke f a                        f l  e h  sl si llem  dr
                                                                  le    ic h   l
                                                                               k

       490       500       510 
....:....|....:....|....:....|.
                               
s------------------------------
rrsrfysgfnsrprgrvyrgraratswyspy
kkyyw              sg          
-qll                           
c  g                           
                               
                               
                               
© 1998-2020Legal notice