Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .                  
------------------------matpasapdtraLvadfvgyklr-----qkgyvcgagpgegpaadplhqa------
mfglqrnaviglnlycggaglgpg--------gg-l-atgylatarqevggg------spstdasspst-apdvrrvarp
                        smssdmsq--h- ---ke-----     ea msiqgfaavrqtr-v----teseae
                         gad frgynar lv --s vms         iweq s seks seereg      
                             efesi m  q   k ca           p l   p en r  aa       
                                r  e      e                                     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spigaegpdvtatparllffaptrlasppeemespasdaimspeeeldgyepeplgkrpavlpllglveeassgpgtdgs
t sain npswhladspavnga ghs sldar vipma vkqa                                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    :.       .  
-----------------------------------------------------mraagdefetrfrrtfsdlaaqlhvtp
lpstpppaeeeedelyrqsleiisrylreqatgakdakpmggsgaasrkaletl-rv--gvqrnhetalqgmlrk-dikn
                                                     -f--qn--------- dvytv- -fsw
                                                     a s aaqirlyyvpc  nfrs    ri
                                                       e      k nk      dg      
                                                       c      e l               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .          ** *:.::: * . :                :       .   :          *:  . 
gsaqqrftqVsdelfqgG-pNWGRlVaffvFgaalcaesvnk---------emeplvgqvqewmvtyLetrladWihssg
eddvkslsramvhvlsdrvt  y iatlis egfvakhlksiacgrkkpevnqyscieplaasitdvnvrtkr- lvkqr
ntvylvawm qnlearp iv    v silt a m mvrhpre    iakdgdvsvecsyivtlliaq tgq--t  rqna
dr rii n  lkk  e  gi         a   i lek ld           tqrd rrfp efc k sshhep  qe  
   e   e   e                                          k   l     a   nd      la  
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                                                                               
GWd-----------------------------------------------------------------------------
speleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgc
  a                                                                             
  r                                                                             
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------gfvefshvesletsl-l-e--f--------------pgirtvltgfvrvryvvrttayls
gsvnrvtilcdkfsghpkgfayialfgkgdvr---r-d-sl-rgrqikvipkrtnr---s-tdravpgaggra-glnfni
                    e-t--ydnsatqearakrvwnw              gsv-s----aaaltalgt-gl-fa
                    -l-ns--dnpqkkwtphsggvt              a l nnklcm---a---av--w--
                    t ml  qgalagafekgq rfn                  wf i  tyc-vkrwssscsw
                    s c   ke f a     m                       e h  sl si llem  dr
                                                                  le    ic h   l
                                                                               k

       490       500       510 
....:....|....:....|....:....|.
                               
s------------------------------
rrsrfysgfnsrprgrvyrgraratswyspy
kkyyw              sg          
-qll                           
c  g                           
                               
                               
                               
© 1998-2020Legal notice