Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

34 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A287B149_MCL1-03      ------------MFGLQRNAVIGLNLYC----------------------
A0A4X1SEZ6_MCL1-03      ------------MFGLQRNAVIGLNLYC----------------------
Q95KR3_MCL1-01          ------------MFGLQRNAVIGLNLYC----------------------
A0A4X1UP21_BCL2A1-      -MTDDEFGYIHMLAQDYLKYVLQI--------------------------
A0A4X1UP21_BCL2A1-      -MTDDEFGYIHMLAQDYLKYVLQI--------------------------
C7F841_BCL2A1-01        -MTDDEFGYIHMLAQDYLKYVLQI--------------------------
A0A4X1T1Z2_BCL2L10      -MADAFRERTARLLTDYLEYCAR---------------------------
F1RZB9_BCL2L10-01       -MADAFRERTARLLTDYLEYCAR---------------------------
A0A4X1SQU7_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
A0A4X1SQU7_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
A0A4X1SQU7_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
A0A4X1SQU7_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
A0A4X1SQU7_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
O77737_BCL2L1-01        -----MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEA
A0A482LX62_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A4X1SF63_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A3Q9B4M8_BCL2L2-      MATPASAPDTRALVADFVGYKMRQKGYV----------------------
A0A287B149_MCL1-02      ------------MFGLQRNAVIGLNLYC----------------------
A0A287B149_MCL1-01      ------------MFGLQRNAVIGLNLYC----------------------
A0A4X1SEZ6_MCL1-01      ------------MFGLQRNAVIGLNLYC----------------------
A0A4X1SEZ6_MCL1-02      ------------MFGLQRNAVIGLNLYC----------------------
A0A4X1UP21_BCL2A1-      -----MTDDEFGYIHMLAQDYLKYVLQI----------------------
A0A287ATE4_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLV----------------------
A0A287ATE4_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLV----------------------
A0A4X1SF63_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLV----------------------
A0A4X1SF63_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLV----------------------
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A4X1SF63_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A4D6NWN1_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A4X1SF63_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
                                                                          

A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A287B149_MCL1-03      -------------------------GGAGLGPGSGSSASAPGGRLLATGA
A0A4X1SEZ6_MCL1-03      -------------------------GGAGLGPGSGSSASAPGGRLLATGA
Q95KR3_MCL1-01          -------------------------GGAGLGPGSGSS-------------
A0A4X1UP21_BCL2A1-      -------------------------PQPG--SGPSKT-------------
A0A4X1UP21_BCL2A1-      -------------------------PQPG--SGPSKT-------------
C7F841_BCL2A1-01        -------------------------PQPG--SGPSKT-------------
A0A4X1T1Z2_BCL2L10      --------------------------EPG--TAARQP-------------
F1RZB9_BCL2L10-01       --------------------------EPG--TAARQP-------------
A0A4X1SQU7_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
A0A4X1SQU7_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
A0A4X1SQU7_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
A0A4X1SQU7_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
A0A4X1SQU7_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
O77737_BCL2L1-01        ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-------------
A0A482LX62_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A287ATE4_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A4X1SF63_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A3Q9B4M8_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A287B149_MCL1-02      -------------------------GGAGLGPGSGSS-------------
A0A287B149_MCL1-01      -------------------------GGAGLGPGSGSS-------------
A0A4X1SEZ6_MCL1-01      -------------------------GGAGLGPGSGSS-------------
A0A4X1SEZ6_MCL1-02      -------------------------GGAGLGPGSGSS-------------
A0A4X1UP21_BCL2A1-      -------------------------PQPG--SGPSKT-------------
A0A287ATE4_BCL2L2-      -------------------------PGAGGEAGEGAP-------------
A0A287ATE4_BCL2L2-      -------------------------PGAGGEAGEGAP-------------
A0A4X1SF63_BCL2L2-      -------------------------PGAGGEAGEGAP-------------
A0A4X1SF63_BCL2L2-      -------------------------PGAGGEAGEGAP-------------
A0A287ATE4_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A4X1SF63_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A287ATE4_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A4D6NWN1_BCL2L2-      -------------------------CGAG--PGEGPA-------------
A0A4X1SF63_BCL2L2-      -------------------------CGAG--PGEGPA-------------
                                                                          

A0A4X1UP21_BCL2A1-      ---MAAAAVSGAKRSLRAELKQRLRAVSAEERLRQSRLLT--------QK
A0A4X1UP21_BCL2A1-      ---MAAAAVSGAKRSLRAELKQRLRAVSAEERLRQSRLLT--------QK
A0A287B149_MCL1-03      KDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR--------KL
A0A4X1SEZ6_MCL1-03      KDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR--------KL
Q95KR3_MCL1-01          ---------------------------------AFQGMLR--------KL
A0A4X1UP21_BCL2A1-      ------------SRVLRDVAFSVQNEVEKNLKPCLDNFDV----------
A0A4X1UP21_BCL2A1-      ------------SRVLRDVAFSVQNEVEKNLKPCLDNFDV----------
C7F841_BCL2A1-01        ------------SRVLRDVAFSVQNEVEKNLKPCLDNFDV----------
A0A4X1T1Z2_BCL2L10      ------------SSPEAAVLRCVAAQIREYNVRTLSVYRG----------
F1RZB9_BCL2L10-01       ------------SSPEAAVLRCVAAQIREYNVRTLSVYRG----------
A0A4X1SQU7_BCL2L1-      ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
A0A4X1SQU7_BCL2L1-      ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
A0A4X1SQU7_BCL2L1-      ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
A0A4X1SQU7_BCL2L1-      ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
A0A4X1SQU7_BCL2L1-      ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
O77737_BCL2L1-01        ------------MAAVKQALREAGDEFELRYRRAFSDLTS--------QL
A0A482LX62_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A287ATE4_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A4X1SF63_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A3Q9B4M8_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A287B149_MCL1-02      ------------ASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASP
A0A287B149_MCL1-01      ------------ASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASP
A0A4X1SEZ6_MCL1-01      ------------ASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASP
A0A4X1SEZ6_MCL1-02      ------------ASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASP
A0A4X1UP21_BCL2A1-      ------------SRVLRDVAFSVQNEVEKNLKPCLDNFDV----------
A0A287ATE4_BCL2L2-      ------------GGAGDYGNGLESEELEP------EELLL--------EP
A0A287ATE4_BCL2L2-      ------------GGAGDYGNGLESEELEP------EELLL--------EP
A0A4X1SF63_BCL2L2-      ------------GGAGDYGNGLESEELEP------EELLL--------EP
A0A4X1SF63_BCL2L2-      ------------GGAGDYGNGLESEELEP------EELLL--------EP
A0A287ATE4_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A4X1SF63_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A287ATE4_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A4D6NWN1_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
A0A4X1SF63_BCL2L2-      ------------ADPLHQAMRAAGDEFETRFRRTFSDLAA--------QL
                                                                          

A0A4X1UP21_BCL2A1-      VIAHSQYLKSKRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQ---
A0A4X1UP21_BCL2A1-      VIAHSQYLKSKRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQ---
A0A287B149_MCL1-03      DIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFG--AFVAKHLKS---
A0A4X1SEZ6_MCL1-03      DIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFG--AFVAKHLKS---
Q95KR3_MCL1-01          DIKNEDDVKSLSRVMVHVLSDGVTNWGRIVTLISFG--AFVAKHLKS---
A0A4X1UP21_BCL2A1-      -VSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFE--GILMKKLLR---
A0A4X1UP21_BCL2A1-      -VSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFE--GILMKKLLR---
C7F841_BCL2A1-01        -VSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFE--GILMKKLLR---
A0A4X1T1Z2_BCL2L10      -FRWNRVELVAWMAQKLLASPRGPNWYRVASLLTFA--GMLLERHPR---
F1RZB9_BCL2L10-01       -FRWNRVELVAWMAQKLLASPRGPNWYRVASLLTFA--GMLLERHPREAC
A0A4X1SQU7_BCL2L1-      HITPGTAYQSFE--------------------------------------
A0A4X1SQU7_BCL2L1-      HITPGTAYQSFEQVVNELFRD-GVNWGRIVAFFSFG--GALCVESVD---
A0A4X1SQU7_BCL2L1-      HITPGTAYQSFEQVVNELFRD-GVNWGRIVAFFSFG--GALCVESVD---
A0A4X1SQU7_BCL2L1-      HITPGTAYQSFEQVVNELFRD-GVNWGRIVAFFSFG--GALCVESVD---
A0A4X1SQU7_BCL2L1-      HITPGTAYQSFEQVVNELFRD-GVNWGRIVAFFSFG--GALCVESVD---
O77737_BCL2L1-01        HITPGTAYQSFEQVLNELFRD-GVNWGRIVAFFSFG--GALCVESVD---
A0A482LX62_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A287ATE4_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A4X1SF63_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A3Q9B4M8_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A287B149_MCL1-02      PSTPAPDARRVARPSPIGAEG--PDVTATPARLLFF--APTRLASPP---
A0A287B149_MCL1-01      PSTPAPDARRVARPSPIGAEG--PDVTATPARLLFF--APTRLASPP---
A0A4X1SEZ6_MCL1-01      PSTPAPDARRVARPSPIGAEG--PDVTATPARLLFF--APTRLASPP---
A0A4X1SEZ6_MCL1-02      PSTPAPDARRVARPSPIGAEG--PDVTATPARLLFF--APTRLASPP---
A0A4X1UP21_BCL2A1-      -VSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFE--GILMKKLLR---
A0A287ATE4_BCL2L2-      EPEPEPEEEPPRPRAPPGAPGPGPGSG--------------APGSQE---
A0A287ATE4_BCL2L2-      EPEPEPEEEPPRPRAPPGAPGPGPGSG--------------APGSQE---
A0A4X1SF63_BCL2L2-      EPEPEPEEEPPRPRAPPGAPGPGPGSG--------------APGSQE---
A0A4X1SF63_BCL2L2-      EPEPEPEEEPPRPRAPPGAPGPGPGSG--------------APGSQE---
A0A287ATE4_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A4X1SF63_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A287ATE4_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A4D6NWN1_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
A0A4X1SF63_BCL2L2-      HVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFG--AALCAESVN---
                                                                          

A0A4X1UP21_BCL2A1-      SNHMDMV-------KLASPEEISSLPKT--S---WNIHQPGEN-------
A0A4X1UP21_BCL2A1-      SNHMDMV-------KLASPEEISSLPKT--S---WNIHQPGEN-------
A0A287B149_MCL1-03      INQESCI-------EPLAESITDVLVRTKRD---WLVKQRGWD-------
A0A4X1SEZ6_MCL1-03      INQESCI-------EPLAESITDVLVRTKRD---WLVKQRGWD-------
Q95KR3_MCL1-01          INQESCI-------EPLAESITDVLVRTKRD---WLVKQRGWD-------
A0A4X1UP21_BCL2A1-      KRIAPDV----DTYKEISYFVAEFITKNTGQ---WIRQNGGWE-------
A0A4X1UP21_BCL2A1-      KRIAPDV----DTYKEISYFVAEFITKNTGQ---WIRQNGGWE-------
C7F841_BCL2A1-01        KRIAPDV----DTYKEISYFVAEFITKNTGQ---WIRQNGGWE-------
A0A4X1T1Z2_BCL2L10      -------------SRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLF--
F1RZB9_BCL2L10-01       GRKKKEG----NVSRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLF--
A0A4X1SQU7_BCL2L1-      ------------------------------------QENGGWDT------
A0A4X1SQU7_BCL2L1-      KEMQVLV-------SRIATWMATYLNDHLEP---WIQENGGWDT------
A0A4X1SQU7_BCL2L1-      KEMQVLV-------SRIATWMATYLNDHLEP---WIQENGGWDT------
A0A4X1SQU7_BCL2L1-      KEMQVLV-------SRIATWMATYLNDHLEP---WIQENGGWDT------
A0A4X1SQU7_BCL2L1-      KEMQVLV-------SRIATWMATYLNDHLEP---WIQENGGWDT------
O77737_BCL2L1-01        KEMQVLV-------SRIATWMATYLNDHLEP---WIQENGGWDT------
A0A482LX62_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSASPRS------
A0A287ATE4_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWAE------
A0A4X1SF63_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWAE------
A0A3Q9B4M8_BCL2L2-      KEMEPLV-------GQVPEWMVTYLETRLAD---WIHSSGGWAE------
A0A287B149_MCL1-02      EEMESPASDAIMSPEE--------------------------ELDGYEPE
A0A287B149_MCL1-01      EEMESPASDAIMSPEE--------------------------ELDGYEPE
A0A4X1SEZ6_MCL1-01      EEMESPASDAIMSPEE--------------------------ELDGYEPE
A0A4X1SEZ6_MCL1-02      EEMESPASDAIMSPEE--------------------------ELDGYEPE
A0A4X1UP21_BCL2A1-      KRIAPDV----DTYKEISYFVAEFITKNTGQ---WIRQNGGW--------
A0A287ATE4_BCL2L2-      EEEEPGLVEGDPGDGAIED----------------------PELEAIKAR
A0A287ATE4_BCL2L2-      EEEEPGLVEGDPGDGAIED----------------------PELEAIKAR
A0A4X1SF63_BCL2L2-      EEEEPGLVEGDPGDGAIED----------------------PELEAIKAR
A0A4X1SF63_BCL2L2-      EEEEPGLVEGDPGDGAIED----------------------PELEAIKAR
A0A287ATE4_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWELEAIKAR
A0A4X1SF63_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWELEAIKAR
A0A287ATE4_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWELEAIKAR
A0A4D6NWN1_BCL2L2-      KEMEPLV-------GQVQEWMVTYLESRLAD---WIHSSGGWELEAIKAR
A0A4X1SF63_BCL2L2-      KEMEPLV-------GQVQEWMVTYLETRLAD---WIHSSGGWELEAIKAR
                                                                          

A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A287B149_MCL1-03      --------------------------------------------------
A0A4X1SEZ6_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A4X1T1Z2_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
A0A287B149_MCL1-02      PLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSLEII
A0A287B149_MCL1-01      PLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSLEII
A0A4X1SEZ6_MCL1-01      PLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSLEII
A0A4X1SEZ6_MCL1-02      PLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSLEII
A0A4X1UP21_BCL2A1-      ----------------------------------VIAHSQYLKSKRISIF
A0A287ATE4_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A287ATE4_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A4X1SF63_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A4X1SF63_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A287ATE4_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A4X1SF63_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A287ATE4_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A4D6NWN1_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A4X1SF63_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
                                                                          

A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A287B149_MCL1-03      --------------------------------------------------
A0A4X1SEZ6_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A4X1T1Z2_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
A0A482LX62_BCL2L2-      ---------------------------------------------LMN--
A0A287ATE4_BCL2L2-      ---------------------------------------------FTA--
A0A4X1SF63_BCL2L2-      ---------------------------------------------FTA--
A0A3Q9B4M8_BCL2L2-      ---------------------------------------------FTA--
A0A287B149_MCL1-02      SRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGML
A0A287B149_MCL1-01      SRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGML
A0A4X1SEZ6_MCL1-01      SRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGML
A0A4X1SEZ6_MCL1-02      SRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGML
A0A4X1UP21_BCL2A1-      LSMPDEIETEEIIRDIFQ-----QGKTCFIPR-------------YQFQS
A0A287ATE4_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A287ATE4_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A4X1SF63_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A4X1SF63_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A287ATE4_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A4X1SF63_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A287ATE4_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A4D6NWN1_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
A0A4X1SF63_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDK-------------FSGHP
                                                                          

A0A4X1UP21_BCL2A1-      ------------------------------------------EIRE----
A0A4X1UP21_BCL2A1-      ------------------------------------------EIRE----
A0A287B149_MCL1-03      ------------------------------------------GFVEFFHV
A0A4X1SEZ6_MCL1-03      ------------------------------------------GFVEFFHV
Q95KR3_MCL1-01          ------------------------------------------GFVEFFHV
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A4X1T1Z2_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
A0A4X1SQU7_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF63_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
A0A287B149_MCL1-02      RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSIN
A0A287B149_MCL1-01      RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSIN
A0A4X1SEZ6_MCL1-01      RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSIN
A0A4X1SEZ6_MCL1-02      RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSIN
A0A4X1UP21_BCL2A1-      NHMDMVKLASPEEI----------------SSLPKTSWNIHQPGENEIRE
A0A287ATE4_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A287ATE4_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A4X1SF63_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A4X1SF63_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A287ATE4_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A4X1SF63_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A287ATE4_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A4D6NWN1_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
A0A4X1SF63_BCL2L2-      KGFAYIEFSDKESV----------------RTSLALDESLFRGRQIKVIP
                                                                          

A0A4X1UP21_BCL2A1-      EALSTGGLDLIFMPGLGFDNCGNRLGRGKGYYDAYLKRCLQSQDVKPYTL
A0A4X1UP21_BCL2A1-      EALSTGGLDLIFMPGLGFDNCGNRLGRGKGYYDAYLKRCLQSQDVKPYTL
A0A287B149_MCL1-03      EDLE-GGIRNVLLAFAGVAGVGAGL--------AYLIR------------
A0A4X1SEZ6_MCL1-03      EDLE-GGIRNVLLAFAGVAGVGAGL--------AYLIR------------
Q95KR3_MCL1-01          EDLE-GGIRNVLLAFAGVAGVGAGL--------AYLIR------------
A0A4X1UP21_BCL2A1-      ---------------------------------NGFVKKFEPKSGWLTFV
A0A4X1UP21_BCL2A1-      ---------------------------------NGFVKKFEPKSGWLTFV
C7F841_BCL2A1-01        ---------------------------------NGFVKKFEPKSGWLTFV
A0A4X1T1Z2_BCL2L10      -------------------------------FQGSLQQTWTRHMVWVFVS
F1RZB9_BCL2L10-01       -------------------------------FQGSLQQTWTRHMVWVFVS
A0A4X1SQU7_BCL2L1-      ------------FVELYGNNAAAESRKGQERFNRW-----------FLTG
A0A4X1SQU7_BCL2L1-      ------------FVELYGNNAAAESRKGQERFNRWPCGSNPPVETQTETG
A0A4X1SQU7_BCL2L1-      ------------FVELYGNNAAAESRKGQERFNRW-----------FLTG
A0A4X1SQU7_BCL2L1-      ------------FVELYGNNAAAESRKGQERFNRW-----------FLTG
A0A4X1SQU7_BCL2L1-      ------------FVELYGNNAAAESRKGQERFNRW-----------FLTG
O77737_BCL2L1-01        ------------FVELYGNNAAAESRKGQERFNRW-----------FLTG
A0A482LX62_BCL2L2-      ------------SSKEAPTGAAL----------------WPSLSSELHCV
A0A287ATE4_BCL2L2-      ------------LYGDGALEEARRLREGN----------WASVRTVLTGA
A0A4X1SF63_BCL2L2-      ------------LYGDGALEEARRLREGN----------WASVRTVLTGA
A0A3Q9B4M8_BCL2L2-      ------------LYGDGALEEARRLREGN----------WASVRTVLTGA
A0A287B149_MCL1-02      QESCIEPLA------ESITDVLVRTKRDW----LVKQRGWDGFVEFFHVE
A0A287B149_MCL1-01      QESCIEPLA------ESITDVLVRTKRDW----LVKQRGWDGFVEFFHVE
A0A4X1SEZ6_MCL1-01      QESCIEPLA------ESITDVLVRTKRDW----LVKQRGWDGFVEFFHVE
A0A4X1SEZ6_MCL1-02      QESCIEPLA------ESITDVLVRTKRDW----LVKQRGWDGFVEFFHVE
A0A4X1UP21_BCL2A1-      EALSTGGLDLIFMPGLGFDNCGNRLGRGKGYYDAYLKRCLQSQDVKPYTL
A0A287ATE4_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A287ATE4_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A4X1SF63_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A4X1SF63_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A287ATE4_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A4X1SF63_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A287ATE4_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A4D6NWN1_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
A0A4X1SF63_BCL2L2-      KRTNRPGIS---TTDRGFPRARYRARTTN--YNSSRSRFYSGFNSRPRGR
                                                                          

A0A4X1UP21_BCL2A1-      ALAFKEQICLQVPMDEHDMKV--ICFPTLQVNL-----------------
A0A4X1UP21_BCL2A1-      ALAFKEQICLQVPMDEHDMKVDEVLYEDSPAS------------------
A0A287B149_MCL1-03      --------------------------------------------------
A0A4X1SEZ6_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A4X1UP21_BCL2A1-      EVTGKICEMLC--LLKQYY-------------------------------
A0A4X1UP21_BCL2A1-      EVTGKICEMLC--LLKQYY-------------------------------
C7F841_BCL2A1-01        EVTGKICEMLC--LLKQYY-------------------------------
A0A4X1T1Z2_BCL2L10      YCTAVV--LLY--LWRKLL-------------------------------
F1RZB9_BCL2L10-01       YCTAVV--LLY--LWRKLL-------------------------------
A0A4X1SQU7_BCL2L1-      MTLAGVVLLGS--LFSRK--------------------------------
A0A4X1SQU7_BCL2L1-      SSHSVDLIQGAPEILPRHKHLQQDLSILPVRPFPHPTPFRFHAGPTSVPS
A0A4X1SQU7_BCL2L1-      MTLAGVVLLGS--LFSRK--------------------------------
A0A4X1SQU7_BCL2L1-      MTLAGVVLLGS--LFSRK--------------------------------
A0A4X1SQU7_BCL2L1-      MTLAGVVLLGS--LFSRK--------------------------------
O77737_BCL2L1-01        MTLAGVVLLGS--LFSRK--------------------------------
A0A482LX62_BCL2L2-      LRVSIRRWSHS--WDKCRSGW-----------------------------
A0A287ATE4_BCL2L2-      VALGALVTVGA--FFASK--------------------------------
A0A4X1SF63_BCL2L2-      VALGALVTVGA--FFASK--------------------------------
A0A3Q9B4M8_BCL2L2-      VALGALVTVGA--FFASK--------------------------------
A0A287B149_MCL1-02      DLEGGIRSNKI--AF-----------------------------------
A0A287B149_MCL1-01      DLEGGIRNVLL--AFAGVAGVGAGLAYLIR--------------------
A0A4X1SEZ6_MCL1-01      DLEGGIRNVLL--AFAGVAGVGAGLAYLIR--------------------
A0A4X1SEZ6_MCL1-02      DLEGGIRNVLL--AFAEKSKWQEDYD------------------------
A0A4X1UP21_BCL2A1-      ALAFKEQICLQ--VPMDEHDMKVICFPTLQVNL-----------------
A0A287ATE4_BCL2L2-      VYRGRAR-ATS--WYSPY--------------------------------
A0A287ATE4_BCL2L2-      VYRGRAR-ATS--WFL----------------------------------
A0A4X1SF63_BCL2L2-      VYRGRAR-ATS--WFL----------------------------------
A0A4X1SF63_BCL2L2-      VYRSG---------------------------------------------
A0A287ATE4_BCL2L2-      VYRSG---------------------------------------------
A0A4X1SF63_BCL2L2-      VYRCTSLFATV--WRK----------------------------------
A0A287ATE4_BCL2L2-      VYRGRAR-ATS--WYSPY--------------------------------
A0A4D6NWN1_BCL2L2-      VYRGRAR-ATS--WYSPY--------------------------------
A0A4X1SF63_BCL2L2-      VYRGRAR-ATS--WYSPY--------------------------------
                                                                          

A0A4X1UP21_BCL2A1-      ---------
A0A4X1UP21_BCL2A1-      ---------
A0A287B149_MCL1-03      ---------
A0A4X1SEZ6_MCL1-03      ---------
Q95KR3_MCL1-01          ---------
A0A4X1UP21_BCL2A1-      ---------
A0A4X1UP21_BCL2A1-      ---------
C7F841_BCL2A1-01        ---------
A0A4X1T1Z2_BCL2L10      ---------
F1RZB9_BCL2L10-01       ---------
A0A4X1SQU7_BCL2L1-      ---------
A0A4X1SQU7_BCL2L1-      DQRRQLRKT
A0A4X1SQU7_BCL2L1-      ---------
A0A4X1SQU7_BCL2L1-      ---------
A0A4X1SQU7_BCL2L1-      ---------
O77737_BCL2L1-01        ---------
A0A482LX62_BCL2L2-      ---------
A0A287ATE4_BCL2L2-      ---------
A0A4X1SF63_BCL2L2-      ---------
A0A3Q9B4M8_BCL2L2-      ---------
A0A287B149_MCL1-02      ---------
A0A287B149_MCL1-01      ---------
A0A4X1SEZ6_MCL1-01      ---------
A0A4X1SEZ6_MCL1-02      ---------
A0A4X1UP21_BCL2A1-      ---------
A0A287ATE4_BCL2L2-      ---------
A0A287ATE4_BCL2L2-      ---------
A0A4X1SF63_BCL2L2-      ---------
A0A4X1SF63_BCL2L2-      ---------
A0A287ATE4_BCL2L2-      ---------
A0A4X1SF63_BCL2L2-      ---------
A0A287ATE4_BCL2L2-      ---------
A0A4D6NWN1_BCL2L2-      ---------
A0A4X1SF63_BCL2L2-      ---------
                                 

© 1998-2020Legal notice