Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C7F841_BCL2A1-01        -------------------------MTDDEFGYIHMLAQDYLKYVLQ---
F1RZB9_BCL2L10-01       -------------------------MADAFRERTARLLTDYLEYCAR---
O77737_BCL2L1-01        -----------------------------MSQSNRELVVDFLSYKLS---
A0A287BK44_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGAKDAKPM---
Q95KR3_MCL1-01          MFGLQRNAVIGLNLYCGGAGLGPGSGSS----------------------
A0A287BK44_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
A0A287BK44_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
A0A287ATE4_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLR---
A0A4D6NWN1_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLR---
A0A287ATE4_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLR---
A0A482LX62_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLR---
A0A287ATE4_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLR---
A0A3Q9B4M8_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKMR---
                                                                          

C7F841_BCL2A1-01        ------IPQPGSGPSKTSRVLRDV--------------------------
F1RZB9_BCL2L10-01       --------EPGTAARQPSSPEAAV--------------------------
O77737_BCL2L1-01        --QKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVN
A0A287BK44_MCL1-03      -----------GGSGAASRKALET--------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-01      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A287BK44_MCL1-02      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A287ATE4_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
A0A4D6NWN1_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
A0A287ATE4_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
A0A482LX62_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
A0A287ATE4_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
A0A3Q9B4M8_BCL2L2-      --QKGYVCGAGPGEGPAADPLHQA--------------------------
                                                                          

C7F841_BCL2A1-01        --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
O77737_BCL2L1-01        GATGHSSSLDAREVIPMAAVKQA---------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-01      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A287BK44_MCL1-02      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
                                                                          

C7F841_BCL2A1-01        --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-01      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
A0A287BK44_MCL1-02      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
                                                                          

C7F841_BCL2A1-01        -------------AFSVQNEVEKNLKPCLDNFDV---VSIDTARIIFNQV
F1RZB9_BCL2L10-01       -------------LRCVAAQIREYNVRTLSVYRG---FRWNRVELVAWMA
O77737_BCL2L1-01        -------------LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
A0A287BK44_MCL1-03      -------------LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
Q95KR3_MCL1-01          ---------------------------AFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-01      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-02      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A287ATE4_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A4D6NWN1_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A287ATE4_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A482LX62_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A287ATE4_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A3Q9B4M8_BCL2L2-      -------------MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
                                                    :.       .           .

C7F841_BCL2A1-01        MEKEFEDGIINWGRIVTIFAFEGILMKKLLRK---RIAPDVDTYKEISYF
F1RZB9_BCL2L10-01       QKLLASPRGPNWYRVASLLTFAGMLLERHPREACGRKKKEGNVSRDCRLL
O77737_BCL2L1-01        LNELFRDG-VNWGRIVAFFSFGGALCVESVDK---------EMQVLVSRI
A0A287BK44_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSI---------NQESCIEPL
Q95KR3_MCL1-01          MVHVLSDGVTNWGRIVTLISFGAFVAKHLKSI---------NQESCIEPL
A0A287BK44_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSI---------NQESCIEPL
A0A287BK44_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSI---------NQESCIEPL
A0A287ATE4_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
A0A4D6NWN1_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
A0A287ATE4_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
A0A482LX62_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
A0A287ATE4_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
A0A3Q9B4M8_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNK---------EMEPLVGQV
                                  ** *:.::: * . :                :       .

C7F841_BCL2A1-01        VAEFITKNTGQ---WIRQNGGWE---------------------------
F1RZB9_BCL2L10-01       VALLCAQLSGQHRTWLLANGGWD---------------------------
O77737_BCL2L1-01        ATWMATYLNDHLEPWIQENGGWD---------------------------
A0A287BK44_MCL1-03      AESITDVLVRTKRDWLVKQRGWD---------------------------
Q95KR3_MCL1-01          AESITDVLVRTKRDWLVKQRGWD---------------------------
A0A287BK44_MCL1-01      AESITDVLVRTKRDWLVKQRGWD---------------------------
A0A287BK44_MCL1-02      AESITDVLVRTKRDWLVKQRGWD---------------------------
A0A287ATE4_BCL2L2-      QEWMVTYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEK
A0A4D6NWN1_BCL2L2-      QEWMVTYLESRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEK
A0A287ATE4_BCL2L2-      QEWMVTYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEK
A0A482LX62_BCL2L2-      QEWMVTYLETRLADWIHSSASPR---------------------------
A0A287ATE4_BCL2L2-      QEWMVTYLETRLADWIHSSGGWA---------------------------
A0A3Q9B4M8_BCL2L2-      PEWMVTYLETRLADWIHSSGGWA---------------------------
                           :          *:  . .                             

C7F841_BCL2A1-01        --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A287ATE4_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC
A0A4D6NWN1_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC
A0A287ATE4_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
                                                                          

C7F841_BCL2A1-01        ---------------------------NGFVKK-----------------
F1RZB9_BCL2L10-01       --------------------GFCLFFQGSLQQT-----------------
O77737_BCL2L1-01        --------------------TFVELYGNNAAAESRKGQERFN--------
A0A287BK44_MCL1-03      --------------------GFVEFFHVEDLE------------------
Q95KR3_MCL1-01          --------------------GFVEFFHVEDLE------------------
A0A287BK44_MCL1-01      --------------------GFVEFFHVEDLE------------------
A0A287BK44_MCL1-02      --------------------GFVEFFHVEDLE------------------
A0A287ATE4_BCL2L2-      GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI
A0A4D6NWN1_BCL2L2-      GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI
A0A287ATE4_BCL2L2-      GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI
A0A482LX62_BCL2L2-      --------------------SLMNSSKEAPTGAAL------W--------
A0A287ATE4_BCL2L2-      --------------------EFTALYGDGALEEARRLREGNW--------
A0A3Q9B4M8_BCL2L2-      --------------------EFTALYGDGALEEARRLREGNW--------
                                                                          

C7F841_BCL2A1-01        ------FEPKSGWLTFVEVTGKICEMLCLLKQYY----------------
F1RZB9_BCL2L10-01       ------WTRHMVWVFVSYCTAVV--LLYLWRKLL----------------
O77737_BCL2L1-01        ---------RWFLTGMTLAGVVLLGSLFSRK-------------------
A0A287BK44_MCL1-03      ------GGIRNVLLAFAGVAGVGAGLAYLIR-------------------
Q95KR3_MCL1-01          ------GGIRNVLLAFAGVAGVGAGLAYLIR-------------------
A0A287BK44_MCL1-01      ------GGIRNVLLAFAGVAGVGAGLAYLIR-------------------
A0A287BK44_MCL1-02      ------GGIRSNKIAF----------------------------------
A0A287ATE4_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG
A0A4D6NWN1_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG
A0A287ATE4_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRS
A0A482LX62_BCL2L2-      ------PSLSSELHCVLRVSIRRWSHSWDKCRSGW---------------
A0A287ATE4_BCL2L2-      ------ASVRTVLTGAVALGALVTVGAFFASK------------------
A0A3Q9B4M8_BCL2L2-      ------ASVRTVLTGAVALGALVTVGAFFASK------------------
                                                                          

C7F841_BCL2A1-01        -----------
F1RZB9_BCL2L10-01       -----------
O77737_BCL2L1-01        -----------
A0A287BK44_MCL1-03      -----------
Q95KR3_MCL1-01          -----------
A0A287BK44_MCL1-01      -----------
A0A287BK44_MCL1-02      -----------
A0A287ATE4_BCL2L2-      RARATSWYSPY
A0A4D6NWN1_BCL2L2-      RARATSWYSPY
A0A287ATE4_BCL2L2-      G----------
A0A482LX62_BCL2L2-      -----------
A0A287ATE4_BCL2L2-      -----------
A0A3Q9B4M8_BCL2L2-      -----------
                                   

© 1998-2020Legal notice