Dataset for protein Bcl-w of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . :: 
MAtpAsApdtralvadfvgyklRqkgyVcGAG--pGEGpaadplhqamraagdEfEtrfrrtfsdLaaqlhvtPgsaqqr
  aa a aaaagaaggrgsgpg rrhl p   gea   apggagdygnglese l p------ee llepepe epeeep
                     m                                                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :     * **. *            .. * ::* ** :       * : :                          
ftqvsdelfqG-GPnwGrlvaffvfgaalcaeSvnkEmEPlv-------Gqvqewmvtyletrladwihssggweleaik
prprappgap p  gs ------------apg qee e  glvegdpgd aied-------------------pa-----
                                                    p        s         as r     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
arvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvti
--------------------------------------------------------------------------------
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   . .   :       :              ..: :                :  ..      
lcdkfsghpkgfayiefsdkesvrtslaLdEslfrgrqikvipkrtnrpgisTtdrGfpraryrarttnynsSrsrfysg
------------eftalygdgaleearr-r-gnw--------------asvrsvltcavalgalvtvgaffack------
            slmns keaptga  - - --                 l  e h vl vsi rwshswdk   gw   
                                                                                

       330       340   
....:....|....:....|...
                       
fnsrprgrvyrgr----------
-------------aratswyspy
           sgslfatvflk 
           ct      wr  
© 1998-2021Legal notice