Dataset for protein Bcl-w of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************:**********************************************************
MATPASAPDTRALVADFVGYKlRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                     m                                                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************** ********:*********..                 
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVqEWMVTYLEtRLADWIHSSggwe---------------
                                          p        s         aspaleaikarvremeeea
                                                                r               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpk
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         . .   :       :              ..: :                :  ..                
--ayiefsdkesvrtslaldeslw--------------psisttlrgfpraryrarttnynssrsrf-------------
gfeftalygdgaleearr-r-gnfrgrqikvipkrtnragvrsvdtcavalgalvtvgaffack---ysgfnsrprgrvy
  slmns keaptga  - - --                 l  e h vl vsi rwshswdk   gw             

       330   
....:....|...
             
-------------
rgraratswyspy
 sg          
© 1998-2020Legal notice