Dataset for protein Bcl-w of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A4D6NWN1_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A482LX62_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A3Q9B4M8_BCL2L2-      MATPASAPDTRALVADFVGYKMRQKGYVCGAGPGEGPAADPLHQAMRAAG
                        *********************:****************************

A0A287ATE4_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A4D6NWN1_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A287ATE4_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A482LX62_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A287ATE4_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A3Q9B4M8_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                        **************************************************

A0A287ATE4_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWELEAIK
A0A4D6NWN1_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVTYLESRLADWIHSSGGWELEAIK
A0A287ATE4_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWELEAIK
A0A482LX62_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSASPR-----
A0A287ATE4_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWA-----
A0A3Q9B4M8_BCL2L2-      VFGAALCAESVNKEMEPLVGQVPEWMVTYLETRLADWIHSSGGWA-----
                        ********************** ********:*********..       

A0A287ATE4_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A4D6NWN1_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A287ATE4_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
                                                                          

A0A287ATE4_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A4D6NWN1_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A287ATE4_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A482LX62_BCL2L2-      ------------------------------------------SLMNSSKE
A0A287ATE4_BCL2L2-      ------------------------------------------EFTALYGD
A0A3Q9B4M8_BCL2L2-      ------------------------------------------EFTALYGD
                                                                         .

A0A287ATE4_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A4D6NWN1_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A287ATE4_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A482LX62_BCL2L2-      APTGAAL------W--------------PSLSSELHCVLRVSIRRWSHSW
A0A287ATE4_BCL2L2-      GALEEARRLREGNW--------------ASVRTVLTGAVALGALVTVGAF
A0A3Q9B4M8_BCL2L2-      GALEEARRLREGNW--------------ASVRTVLTGAVALGALVTVGAF
                         .   :       :              ..: :                :

A0A287ATE4_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4D6NWN1_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A287ATE4_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRSG----------
A0A482LX62_BCL2L2-      DKCRSGW--------------------------
A0A287ATE4_BCL2L2-      FASK-----------------------------
A0A3Q9B4M8_BCL2L2-      FASK-----------------------------
                          ..                             

© 1998-2020Legal notice