Dataset for protein Bcl-w of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A482LX62_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A4X1SF60_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A3Q9B4M8_BCL2L2-      MATPASAPDTRALVADFVGYKMRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A4X1SF60_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A287ATE4_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A287ATE4_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A4X1SF60_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A4D6NWN1_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A4X1SF60_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A287ATE4_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A4X1SF60_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
                        **:.*:*. : . ...  .   *..  * ***  .***.....   .   

A0A482LX62_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A287ATE4_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A4X1SF60_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A3Q9B4M8_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A4X1SF60_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
A0A287ATE4_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
A0A287ATE4_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
A0A4X1SF60_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
A0A287ATE4_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A4D6NWN1_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A4X1SF60_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A287ATE4_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A4X1SF60_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
                         .:*:*.      .:*  :    * . ::     :     * **. *   

A0A482LX62_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A287ATE4_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A4X1SF60_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A3Q9B4M8_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVPEWMVTYLETRLADWIHS
A0A4X1SF60_BCL2L2-      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
A0A287ATE4_BCL2L2-      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
A0A287ATE4_BCL2L2-      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
A0A4X1SF60_BCL2L2-      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
A0A287ATE4_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A4D6NWN1_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLESRLADWIHS
A0A4X1SF60_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A287ATE4_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
A0A4X1SF60_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVTYLETRLADWIHS
                                 .. * ::* ** :       * : :                

A0A482LX62_BCL2L2-      SASPR---------------------------------------------
A0A287ATE4_BCL2L2-      SGGWA---------------------------------------------
A0A4X1SF60_BCL2L2-      SGGWA---------------------------------------------
A0A3Q9B4M8_BCL2L2-      SGGWA---------------------------------------------
A0A4X1SF60_BCL2L2-      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A287ATE4_BCL2L2-      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A287ATE4_BCL2L2-      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A4X1SF60_BCL2L2-      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A287ATE4_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A4D6NWN1_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A4X1SF60_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A287ATE4_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A4X1SF60_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
                                                                          

A0A482LX62_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4X1SF60_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
A0A4X1SF60_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A287ATE4_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A287ATE4_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A4X1SF60_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A287ATE4_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A4D6NWN1_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A4X1SF60_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A287ATE4_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A4X1SF60_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
                                                                          

A0A482LX62_BCL2L2-      --SLMNSSKEAPTGAAL------W--------------PSLSSELHCVLR
A0A287ATE4_BCL2L2-      --EFTALYGDGALEEARRLREGNW--------------ASVRTVLTGAVA
A0A4X1SF60_BCL2L2-      --EFTALYGDGALEEARRLREGNW--------------ASVRTVLTGAVA
A0A3Q9B4M8_BCL2L2-      --EFTALYGDGALEEARRLREGNW--------------ASVRTVLTGAVA
A0A4X1SF60_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A287ATE4_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A287ATE4_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A4X1SF60_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A287ATE4_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A4D6NWN1_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A4X1SF60_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A287ATE4_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A4X1SF60_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
                                 . .   :       :              ..: :       

A0A482LX62_BCL2L2-      VSIRRWSHSWDKCRSGW--------------------------
A0A287ATE4_BCL2L2-      LGALVTVGAFFASK-----------------------------
A0A4X1SF60_BCL2L2-      LGALVTVGAFFASK-----------------------------
A0A3Q9B4M8_BCL2L2-      LGALVTVGAFFASK-----------------------------
A0A4X1SF60_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A287ATE4_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A287ATE4_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
A0A4X1SF60_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
A0A287ATE4_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4D6NWN1_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4X1SF60_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A287ATE4_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A4X1SF60_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRCTSLFATVWRK-
                                 :  ..                             

© 1998-2022Legal notice