Dataset for protein Bcl-xL of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************                                    
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
                                            ------------------------------------
                                              l                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *******************************             ** : :  :: *: 
vlvsriatwmatylndhlepwiQENGGWDTFVELYGNNAAAESRKGQERFNRW-----------flTGmtlagvvllGs-
----------------------                               pcgsnppvetqte  sshsvdliq ap
                                                                                

       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
 ::.*:                                         
-lfsRk-----------------------------------------
eilp hkhlqqdlsilpvrpfphptpfrfhagptsvpsdqrrqlrkt
                                               
© 1998-2020Legal notice