Dataset for protein Bcl-xL of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1SQU7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
A0A4X1SQU7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
A0A4X1SQU7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
A0A4X1SQU7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
A0A4X1SQU7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
O77737_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSA
                        **************************************************

A0A4X1SQU7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A4X1SQU7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A4X1SQU7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A4X1SQU7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A4X1SQU7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
O77737_BCL2L1-01        INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************************************************

A0A4X1SQU7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFE--------------------------
A0A4X1SQU7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A4X1SQU7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A4X1SQU7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A4X1SQU7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
O77737_BCL2L1-01        YRRAFSDLTSQLHITPGTAYQSFEQVLNELFRDGVNWGRIVAFFSFGGAL
                        ************************                          

A0A4X1SQU7_BCL2L1-      --------------------------------QENGGWDTFVELYGNNAA
A0A4X1SQU7_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A4X1SQU7_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A4X1SQU7_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A4X1SQU7_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
O77737_BCL2L1-01        CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                                                        ******************

A0A4X1SQU7_BCL2L1-      AESRKGQERFNRW-----------FLTGMTLAGVVLLGS--LFSRK----
A0A4X1SQU7_BCL2L1-      AESRKGQERFNRWPCGSNPPVETQTETGSSHSVDLIQGAPEILPRHKHLQ
A0A4X1SQU7_BCL2L1-      AESRKGQERFNRW-----------FLTGMTLAGVVLLGS--LFSRK----
A0A4X1SQU7_BCL2L1-      AESRKGQERFNRW-----------FLTGMTLAGVVLLGS--LFSRK----
A0A4X1SQU7_BCL2L1-      AESRKGQERFNRW-----------FLTGMTLAGVVLLGS--LFSRK----
O77737_BCL2L1-01        AESRKGQERFNRW-----------FLTGMTLAGVVLLGS--LFSRK----
                        *************             ** : :  :: *:  ::.*:    

A0A4X1SQU7_BCL2L1-      -------------------------------------
A0A4X1SQU7_BCL2L1-      QDLSILPVRPFPHPTPFRFHAGPTSVPSDQRRQLRKT
A0A4X1SQU7_BCL2L1-      -------------------------------------
A0A4X1SQU7_BCL2L1-      -------------------------------------
A0A4X1SQU7_BCL2L1-      -------------------------------------
O77737_BCL2L1-01        -------------------------------------
                                                             

© 1998-2020Legal notice