Dataset for protein Bfl1 of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       :* :. . .:..*.. *.:                      
mtddefgyihmlaqdylkyvlqipqpgsgpsktsrvlrdvAfsvqneveknLkpcLdnfdvvsidtariifnqvmekefe
---------------------------------------m aaavsgakrs rae kq----------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *: :: * * :  ..** :.:                                                    
dgiinwgRivtifAfEgilmkkLLrkriapdvdtykeisyfvaefitkntgqwirqnggw--------------------
------- lravs e rlrqsr  tqkv--------------------------------viahsqylkskrisiflsmp
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .::                    **:.*                     * *:   * 
----------------ktgFvpryq--------------------PKtsW---------------------LtFvpvtG-
deieteeiirdifqqgenc ikkfefqsnhmdmvklaspeeissl  sg nihqpgeneireealstggld i megl f
                                                                                

       250       260       270       280       290       300     
....:....|....:....|....:....|....:....|....:....|....:....|....:
                                      :**          ::  :         
--------------------------------------qIC----------kv--lcl--lkqyy
dncgnrlgrgkgyydaylkrclqsqdvkpytlalafkek  lqvpmdehdmemdeilfptsqvnl
                                                       v yed pas-
© 1998-2020Legal notice