Dataset for protein Bfl1 of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:   ..  :   .  **  *.  .. .   ::  : ..*    *   .*.:.  *.  * :. :       ::: . *:
MtddefgyihmlaqdyLKyvLqipqpgsgpsktsrvlrdVafsvQneveKnlkpcLdnfDvvsidtariifnqvmekeFe
 aaaavsgakrslrae  qr ravsaeerlrqsrlltqk iahs ylks risif smp eiete-------eiirdi q
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*   :   :. : *:.  * .::.   . ::.:  :                                           
dGiinwgrivtifaFegilMkkllrkriapdvdtykei------------------------------------------
q ktcf---ipryq qsnh -dmvklaspeeisslpktsyfvaefitkntgqwirqnggwviahsqylkskrisiflsmp
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                *:                       *:. :  
------------------------------------------------Sy-----------------------Fvpglit
deieteeiirdifqqgktcfipryqfqsnhmdmvklaspeeisslpkt wnihqpgeneireealstggldli maefgf
                                                                                

       250       260       270       280       290       300        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
.* *:.: .. *: :.::*.      .:* :  *:* *   :**  : : ::                
kNtGqwlrrnkGyyngyvKr------vkPytlwLtFvE---qIClqvpmlkqyy--------------
d c nrigqgg wedafl kclqsqdfe ksga a k vtgk  emlcldehdmkvdeicfptlqvnl
                                                          vlyedspas 
© 1998-2021Legal notice