Dataset for protein Bfl1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
A0A4X1UP21_BCL2A1-      MAAAAVSGAKRSLRAELKQRLRAVSAEERLRQSRLLTQKVIAHSQYLKSK
A0A4X1UP21_BCL2A1-      MAAAAVSGAKRSLRAELKQRLRAVSAEERLRQSRLLTQKVIAHSQYLKSK
A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
C7F841_BCL2A1-01        MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
                        *:   ..  :   .  **  *.  .. .   ::  : ..*    *   .*

A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
A0A4X1UP21_BCL2A1-      RISIFLSMPDEIETE-------EIIRDIFQQGKTCF---IPRYQFQSNHM
A0A4X1UP21_BCL2A1-      RISIFLSMPDEIETE-------EIIRDIFQQGKTCF---IPRYQFQSNHM
A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
C7F841_BCL2A1-01        NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
                        .:.  *.  * :. :       ::: . *::*   :   :. : *:.  *

A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWVIAHSQYLKS
A0A4X1UP21_BCL2A1-      -DMVKLASPEEISSLPKT--------------------------------
A0A4X1UP21_BCL2A1-      -DMVKLASPEEISSLPKT--------------------------------
A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEI--------------------------------
A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEI--------------------------------
C7F841_BCL2A1-01        KKLLRKRIAPDVDTYKEI--------------------------------
                         .::.   . ::.:  :                                 

A0A4X1UP21_BCL2A1-      KRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQSNHMDMVKLASPE
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
A0A4X1UP21_BCL2A1-      --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
                                                                          

A0A4X1UP21_BCL2A1-      EISSLPKTSWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      --------SWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      --------SWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      --------SY-----------------------FVAEFITKNTGQWIRQN
A0A4X1UP21_BCL2A1-      --------SY-----------------------FVAEFITKNTGQWIRQN
C7F841_BCL2A1-01        --------SY-----------------------FVAEFITKNTGQWIRQN
                                *:                       *:. :  .* *:.: ..

A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKE---QICLQVPMDEHDMKV--IC
A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKE---QICLQVPMDEHDMKV--IC
A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKE---QICLQVPMDEHDMKVDEVL
A0A4X1UP21_BCL2A1-      GGWENGFVKK------FEPKSGWLTFVEVTGKICEMLCLLKQYY------
A0A4X1UP21_BCL2A1-      GGWENGFVKK------FEPKSGWLTFVEVTGKICEMLCLLKQYY------
C7F841_BCL2A1-01        GGWENGFVKK------FEPKSGWLTFVEVTGKICEMLCLLKQYY------
                         *: :.::*.      .:* :  *:* *   :**  : : ::        

A0A4X1UP21_BCL2A1-      FPTLQVNL
A0A4X1UP21_BCL2A1-      FPTLQVNL
A0A4X1UP21_BCL2A1-      YEDSPAS-
A0A4X1UP21_BCL2A1-      --------
A0A4X1UP21_BCL2A1-      --------
C7F841_BCL2A1-01        --------
                                

© 1998-2021Legal notice