Dataset for protein Bfl1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1UP21_BCL2A1-      ---------------------------------------MAAAAVSGAKR
A0A4X1UP21_BCL2A1-      ---------------------------------------MAAAAVSGAKR
A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
A0A4X1UP21_BCL2A1-      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
C7F841_BCL2A1-01        MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
                                                               :* :. . .:.

A0A4X1UP21_BCL2A1-      SLRAELKQ-----------------------------RLRAVSAEERLRQ
A0A4X1UP21_BCL2A1-      SLRAELKQ-----------------------------RLRAVSAEERLRQ
A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
A0A4X1UP21_BCL2A1-      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
C7F841_BCL2A1-01        NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
                        .*.. *.:                             *: :: * * :  

A0A4X1UP21_BCL2A1-      SRLLTQKV---------------------------------IAHSQYLKS
A0A4X1UP21_BCL2A1-      SRLLTQKV---------------------------------IAHSQYLKS
A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWVIAHSQYLKS
A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGW----------
A0A4X1UP21_BCL2A1-      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGW----------
C7F841_BCL2A1-01        KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGW----------
                        ..** :.:                                          

A0A4X1UP21_BCL2A1-      KRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQSNHMDMVKLASPE
A0A4X1UP21_BCL2A1-      KRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQSNHMDMVKLASPE
A0A4X1UP21_BCL2A1-      KRISIFLSMPDEIETEEIIRDIFQQGKTCFIPRYQFQSNHMDMVKLASPE
A0A4X1UP21_BCL2A1-      --------------------------ENGFVKKFE---------------
A0A4X1UP21_BCL2A1-      --------------------------ENGFVKKFE---------------
C7F841_BCL2A1-01        --------------------------ENGFVKKFE---------------
                                                  :. *: .::               

A0A4X1UP21_BCL2A1-      EISSLPKTSWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      EISSLPKTSWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      EISSLPKTSWNIHQPGENEIREEALSTGGLDLIFMPGLGFDNCGNRLGRG
A0A4X1UP21_BCL2A1-      -----PKSGW---------------------LTFVEVTG-----------
A0A4X1UP21_BCL2A1-      -----PKSGW---------------------LTFVEVTG-----------
C7F841_BCL2A1-01        -----PKSGW---------------------LTFVEVTG-----------
                             **:.*                     * *:   *           

A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPMDEHDMKV--ICFPT
A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPMDEHDMKVDEVLYED
A0A4X1UP21_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPMDEHDMKV--ICFPT
A0A4X1UP21_BCL2A1-      ----------------------------KIC----------EM--LCL--
A0A4X1UP21_BCL2A1-      ----------------------------KIC----------EM--LCL--
C7F841_BCL2A1-01        ----------------------------KIC----------EM--LCL--
                                                    :**          ::  :    

A0A4X1UP21_BCL2A1-      LQVNL
A0A4X1UP21_BCL2A1-      SPAS-
A0A4X1UP21_BCL2A1-      LQVNL
A0A4X1UP21_BCL2A1-      LKQYY
A0A4X1UP21_BCL2A1-      LKQYY
C7F841_BCL2A1-01        LKQYY
                             

© 1998-2020Legal notice