Dataset for protein BCL-2-like of organism Sinocyclocheilus grahami

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------pcyynral-v--sssglgrkpl------p-n-ftgnglqgsvpsspepdcee---
mslspalpresmfpgskvsndkgfw--igit--v-nsi-g-------vmpelk-q-q---------t------g---vqd
           egea vllkttrvsss----svnqhf-r-kxsqrnyxxxxxxxyxhieftedtnr-ddpqgn-saaaag
                  qhpsnqrmavsvkect faakyxfxxxxx      ax vwavd slpt saaeml dq i  
                     mamenvldlan   ky hh  wk g           s a  hdd   ngl t r     
                     a l ggfag      n                                   m       
                                    i                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              :  .*::        *  
--------lemdtreiid-flr--tg-phrksgntqvlatvnrvv----eslvvkhelaykgmlqrLqlesqgedvSFvk
eytsiyda----------i--ksv--f--s----k----amkealrdsaaevemrysi-fndliaq nitqktdyqr ig
ttnlvngs nrtstqstltpy-nrastcq-qtnlhhgcs------ptigndfll---qf-a- ss  dpaaahm  -e
m     a  dg   gllgd p tp  m p drkg-ga p lttdd ea d----lly-ds-e  k      ip  l   t
d                 a    f  l d ggsr dp d  hp      -risrc qs                      
                                ek                  aa                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   :* *.  ****: .:. **. :*    :      *  :.  :: **    . *: .: .                
tvatevFsDgttNWGRIvsLvaFGavvCshqnekqrsrcVstvaqeissYLltdqhdWllnnkgWhgFveffrvpdtesv
cimetm r ni-    vagflt  gal krlkdlglekl eligkwmtv  istirp iqkqna-d------h-env-aa
s id l n d     ia fe   t  vecvnremtph gs  eq  e  dnklqg   s g  er aalygr---s--
a  k             c       m   q      gv  dn  gl     ngp      e    -a   i -kqrmavt
                                                   e                    dad es
                                                                            a  f
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .        .  :.  :                                                     
vrnt-----lmavggvatfGaglaylIr----------------------------------------------------
i-sassivtwvsivscvgisyavgfylaskrlsttdygndthraspdppahccntccgylsqaahgcytqwntskamrqy
rs--enfkkvlllkmlllv vvislm kqyvggne                                             
-k w      fggaltgft lt  sk   s f                                                
m  q        a a  a   p                                                        
                                                                                
                                                                                

       330
....:....|
          
----------
mssqvkspfi
          
          
          
          
          
© 1998-2020Legal notice