Dataset for protein BCL-2-like of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672T179_BCL2-01      -----------------------------------------MAQENVYDN
A0A672K8R2_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGM
A0A672N8N5_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEEAAGT
A0A672PT04_MCL1-02      ----------------------------------------VQKPARVRGG
A0A672PT04_MCL1-01      -----------------------MSLSPALPRESEGEASVLSHTTNLSSA
A0A672RP45_MCL1-03      ----------------------------------MFPGSKVLNDKGFWPC
A0A672RP45_MCL1-01      ----------------------------------MFPGSKVLNDKGFWPC
A0A672KMK1_MCL1-01      ----------------------------------MFPGSKVSNDSGFWPC
A0A672RP45_MCL1-02      ----------------------------------------------MWSA
                                                                          

A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672T179_BCL2-01      RSLVVKYIHHKLWKKG----YVWEVNGHDDSVSNGLMMGRQEDRGGSRHD
A0A672K8R2_BCL2L1-      TNLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTG---------------
A0A672N8N5_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTG---------------
A0A672PT04_MCL1-02      VSGKSVTQHAARS-------------------------TTPDPQELGSAE
A0A672PT04_MCL1-01      LALTACTQHAARSXXXXXXXXXXXXXXXXVSAADGSLPSTPDPQELGSAE
A0A672RP45_MCL1-03      IGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEE
A0A672RP45_MCL1-01      IGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEE
A0A672KMK1_MCL1-01      IGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGSVPSSPETDCEE
A0A672RP45_MCL1-02      FYVRNL---ISSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEE
                                                                          

A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      -----------------------------------------PDDPTIAAR
A0A672T179_BCL2-01      -----------------------------------PCSALHTVLREAGDE
A0A672K8R2_BCL2L1-      -----------------------------------GLDAVKEALRDSANE
A0A672N8N5_BCL2L1-      -----------------------------------GLDAVKEALRDSANE
A0A672PT04_MCL1-02      -----------LDRDTRQLLLDFYRTRTGMCPRDRKLHHALPTVTRVVAD
A0A672PT04_MCL1-01      -----------LDRDTRQLLLDFYRTRTGMCPRDRKLHHALPTVTRVVAD
A0A672RP45_MCL1-03      VQDEYTSIYDALEMDTREIIDIFLKNVTGFPHSKSGNKQVLATMNRVVES
A0A672RP45_MCL1-01      VQDEYTSIYDALEMDTREIIDIFLKNVTGFPHSKSGNKQVLATMNRVVES
A0A672KMK1_MCL1-01      I-DDYTSIYAALEMDTREIIDAFLKSFTGLPHSKSEKTQVLSTMKRVVDS
A0A672RP45_MCL1-02      VQDEYTSIYDALEMDTREIIDIFLKNVTGFPHSKSGNKQVLATMNRVVES
                                                                          

A0A672K136_MCL1-01      -----------MLQRLQLESQADDMSFIGCIAETMFNDNTTNWGRIVSLV
A0A672KAT0_MCL1-01      ISACLYIFSAGMLQRLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRVVSLV
A0A672T179_BCL2-01      LERLYQSDFAEMSKQLHLTSITAHQRF-TAVIDELFRDGV-NWGRIIAFF
A0A672K8R2_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSF-ESVMDEVFRDGV-NWGRIVGLF
A0A672N8N5_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSF-ESVMDEVFRDGV-NWGRIVGLF
A0A672PT04_MCL1-02      VLVKHEIAYKGMLQRLQLESQADDMSFIGCIAETMFNDNTTNWGRIVSLV
A0A672PT04_MCL1-01      VLVKHEIAYKGMLQRLQLESQADDMSFIGCIAETMFNDNTTNWGRIVSLV
A0A672RP45_MCL1-03      LVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWGRIASLL
A0A672RP45_MCL1-01      LVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWGRIASLL
A0A672KMK1_MCL1-01      LAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGRICSLL
A0A672RP45_MCL1-02      LVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWGRIASLL
                                   :  .*::        *   :   :* *.  ****: .:.

A0A672K136_MCL1-01      AFGAVVCSRLKELQRERCVETVAQQISSYLISDQHDWLLNNKGWHGFVEF
A0A672KAT0_MCL1-01      AFGAVVCSQLKELQRERCVETVAQLISSYLISEQHDWLLNNKGWHGFVAF
A0A672T179_BCL2-01      EFGGTVCVECVNKEMTVHVDNIAGWMTEYLNGPLHGWIQENGGWEAFVEL
A0A672K8R2_BCL2L1-      AFGGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQSQGG-------
A0A672N8N5_BCL2L1-      AFGGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEI
A0A672PT04_MCL1-02      AFGAVVCSRLKELQRERCVETVAQQISSYLISDQHDWLLNNKGWHGFVEF
A0A672PT04_MCL1-01      AFGAVVCSRLKELQRERCVETVAQQISSYLISDQHDWLLNNKGWHGFVEF
A0A672RP45_MCL1-03      AFGAVVCKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEF
A0A672RP45_MCL1-01      AFGAVVCKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEF
A0A672KMK1_MCL1-01      TFGAMVCKHQNDRGLGKCVSLVGEEISSYLLTDQRDWLLKNKAWDGFVEF
A0A672RP45_MCL1-02      AFGAVVCKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEF
                         **. :*    :      *  :.  :: **    . *: .: .       

A0A672K136_MCL1-01      FRVEDVESVIRNA-----LMAVVGCAGIGAGLAFLIR-------------
A0A672KAT0_MCL1-01      FRVEDMESVVRSA-----LMAVVGCAGIGAGLALLIR-------------
A0A672T179_BCL2-01      YGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK-----------
A0A672K8R2_BCL2L1-      ------------------WVSGKLLVFFSYPVSLKIKSYRFGTT------
A0A672N8N5_BCL2L1-      FGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL---------
A0A672PT04_MCL1-02      FRVEDVESVIRNA-----LMAVVGCAGIGAGLAFLIR-------------
A0A672PT04_MCL1-01      FRVEDVESVIRNA-----LMAVVGCAGIGAGLAFLIR-------------
A0A672RP45_MCL1-03      FHVPNTEAAVRNT-----LMAIGSVATFGAALAYLIRSSVGSNEDYGNDT
A0A672RP45_MCL1-01      FHVPNTEAAVRNT-----LMAIGSVATFGAALAYLIR-------------
A0A672KMK1_MCL1-01      FHVPDTEATMRNT-----LMAIGGVATFGAALAYMIR-------------
A0A672RP45_MCL1-02      FHVPNTEAAVRNT-----LMAIGSVATFGAALAYLIR-------------
                                           .        .  :.  :              

A0A672K136_MCL1-01      -------------------------------------------------
A0A672KAT0_MCL1-01      -------------------------------------------------
A0A672T179_BCL2-01      -------------------------------------------------
A0A672K8R2_BCL2L1-      -------------------------------------------------
A0A672N8N5_BCL2L1-      -------------------------------------------------
A0A672PT04_MCL1-02      -------------------------------------------------
A0A672PT04_MCL1-01      -------------------------------------------------
A0A672RP45_MCL1-03      HRASPDPPAHCCNTCCGYLSQAAHGCYTQWNTSKAMRQYMSSQVKSPFI
A0A672RP45_MCL1-01      -------------------------------------------------
A0A672KMK1_MCL1-01      -------------------------------------------------
A0A672RP45_MCL1-02      -------------------------------------------------
                                                                         

© 1998-2021Legal notice