Dataset for protein BCL-2-like of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672T179_BCL2-01      ---------------------MAQENVYDNRSLVVKYIHHKLWKKGYV--
A0A672K8R2_BCL2L1-      -------------------------MSYYNRELVVFFIKYKLSQRNY---
A0A672N8N5_BCL2L1-      -------------------------MSYYNRELVVFFIKYKLSQRNY---
A0A672KMK1_MCL1-01      -----------MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMP
A0A672RP45_MCL1-02      -----------------------MWSAFYVRNL---ISSGGLGRKPLVMP
A0A672RP45_MCL1-01      -----------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMP
A0A672RP45_MCL1-03      -----------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMP
A0A672PT04_MCL1-01      MSLSPALPRESEGEASVLSHTTNLSSALALTACTQHAARSXXXXXXXXXX
A0A672PT04_MCL1-02      -----------------VQKPARVRGGVSGKSVTQHAARS----------
                                                                          

A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672T179_BCL2-01      -------WEVNGHDDSVSNGLMMGRQE-----------------------
A0A672K8R2_BCL2L1-      ---PYNHIEFTEDTNRTDAAEGNDDEAAAGMTNLVNGSLNGTSTGSTGTP
A0A672N8N5_BCL2L1-      ---PYNHIEFTEDTNRTDAAEGNDDEEAAGTTTLVNGSLNGTSTGSTGTP
A0A672KMK1_MCL1-01      ELKAQNQFTGNGLQGSVPSSPETDCEEI-DDYTSIYAALEMDTREIIDAF
A0A672RP45_MCL1-02      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672RP45_MCL1-01      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672RP45_MCL1-03      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672PT04_MCL1-01      XXXXXXVSAADGSLPSTPDPQELGSAE-----------LDRDTRQLLLDF
A0A672PT04_MCL1-02      ---------------TTPDPQELGSAE-----------LDRDTRQLLLDF
                                                                          

A0A672K136_MCL1-01      ------------------------------------------MLQRLQLE
A0A672KAT0_MCL1-01      ----------------------PDDPTIAARISACLYIFSAGMLQRLQLD
A0A672T179_BCL2-01      --------DRGGSRHDPCSALHTVLREAGDELERLYQSDFAEMSKQLHLT
A0A672K8R2_BCL2L1-      PRSPASTPQRQTNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHIT
A0A672N8N5_BCL2L1-      PRSPASTPQRQTNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHIT
A0A672KMK1_MCL1-01      LKSFTGLPHSKSEKTQVLSTMKRVV----DSLAVKHELAYKGMIARLNLE
A0A672RP45_MCL1-02      LKNVTGFPHSKSGNKQVLATMNRVV----ESLVMKHELAYKGMIARLNLE
A0A672RP45_MCL1-01      LKNVTGFPHSKSGNKQVLATMNRVV----ESLVMKHELAYKGMIARLNLE
A0A672RP45_MCL1-03      LKNVTGFPHSKSGNKQVLATMNRVV----ESLVMKHELAYKGMIARLNLE
A0A672PT04_MCL1-01      YRTRTGMCPRDRKLHHALPTVTRVV----ADVLVKHEIAYKGMLQRLQLE
A0A672PT04_MCL1-02      YRTRTGMCPRDRKLHHALPTVTRVV----ADVLVKHEIAYKGMLQRLQLE
                                                                  :  .*:: 

A0A672K136_MCL1-01      SQADDMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCV
A0A672KAT0_MCL1-01      SQPDDLSFIGCIAKTMFRDDTTNWGRVVSLVAFGAVVCSQLKELQRERCV
A0A672T179_BCL2-01      SITAHQRF-TAVIDELFRDGV-NWGRIIAFFEFGGTVCVECVNKEMTVHV
A0A672K8R2_BCL2L1-      PATAYQSF-ESVMDEVFRDGV-NWGRIVGLFAFGGALCVECVEKEMSPLV
A0A672N8N5_BCL2L1-      PATAYQSF-ESVMDEVFRDGV-NWGRIVGLFAFGGALCVECVEKEMSPLV
A0A672KMK1_MCL1-01      QKGEDVSFVKTVATELFSDGITNWGRICSLLTFGAMVCKHQNDRGLGKCV
A0A672RP45_MCL1-02      QKGEDVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCV
A0A672RP45_MCL1-01      QKGEDVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCV
A0A672RP45_MCL1-03      QKGEDVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCV
A0A672PT04_MCL1-01      SQADDMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCV
A0A672PT04_MCL1-02      SQADDMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCV
                               *   :   :* *.  ****: .:. **. :*    :      *

A0A672K136_MCL1-01      ETVAQQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNA-----L
A0A672KAT0_MCL1-01      ETVAQLISSYLISEQHDWLLNNKGWHGFVAFFRVEDMESVVRSA-----L
A0A672T179_BCL2-01      DNIAGWMTEYLNGPLHGWIQENGGWEAFVELYGRQRDSVFRSSWSSIVTV
A0A672K8R2_BCL2L1-      GSIAEWMTVYLDNKIQPWIQSQGG-------------------------W
A0A672N8N5_BCL2L1-      GSIADWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKW
A0A672KMK1_MCL1-01      SLVGEEISSYLLTDQRDWLLKNKAWDGFVEFFHVPDTEATMRNT-----L
A0A672RP45_MCL1-02      SLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNT-----L
A0A672RP45_MCL1-01      SLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNT-----L
A0A672RP45_MCL1-03      SLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNT-----L
A0A672PT04_MCL1-01      ETVAQQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNA-----L
A0A672PT04_MCL1-02      ETVAQQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNA-----L
                          :.  :: **    . *: .: .                          

A0A672K136_MCL1-01      MAVVGCAGIGAGLAFLIR--------------------------------
A0A672KAT0_MCL1-01      MAVVGCAGIGAGLALLIR--------------------------------
A0A672T179_BCL2-01      FGLAALGAVGLTIGAYLAQK------------------------------
A0A672K8R2_BCL2L1-      VSGKLLVFFSYPVSLKIKSYRFGTT-------------------------
A0A672N8N5_BCL2L1-      LLAGMTLLTGVVVGSLIAQKRL----------------------------
A0A672KMK1_MCL1-01      MAIGGVATFGAALAYMIR--------------------------------
A0A672RP45_MCL1-02      MAIGSVATFGAALAYLIR--------------------------------
A0A672RP45_MCL1-01      MAIGSVATFGAALAYLIR--------------------------------
A0A672RP45_MCL1-03      MAIGSVATFGAALAYLIRSSVGSNEDYGNDTHRASPDPPAHCCNTCCGYL
A0A672PT04_MCL1-01      MAVVGCAGIGAGLAFLIR--------------------------------
A0A672PT04_MCL1-02      MAVVGCAGIGAGLAFLIR--------------------------------
                        .        .  :.  :                                 

A0A672K136_MCL1-01      ------------------------------
A0A672KAT0_MCL1-01      ------------------------------
A0A672T179_BCL2-01      ------------------------------
A0A672K8R2_BCL2L1-      ------------------------------
A0A672N8N5_BCL2L1-      ------------------------------
A0A672KMK1_MCL1-01      ------------------------------
A0A672RP45_MCL1-02      ------------------------------
A0A672RP45_MCL1-01      ------------------------------
A0A672RP45_MCL1-03      SQAAHGCYTQWNTSKAMRQYMSSQVKSPFI
A0A672PT04_MCL1-01      ------------------------------
A0A672PT04_MCL1-02      ------------------------------
                                                      

© 1998-2020Legal notice