Dataset for protein BCL-2-like of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *   :                          . : .  *:*   :.            
m-------vvffskyklsqrnyPynhieftedtnrtdaaegnd---dperagtnqltggsLnGt-ssgstgtpprspds-
-syynrelmfpgi-vtndtgfw cigltalnvn-ssggldrkplvgmeaappqtnfinnq q svvtspdtsleet-tpy
 tlslvrr-----lmsahsalv maa kvr---s-dsefseplaa k vlkaa g v lg d rfp agkpdc svqaeq
        taav  ll  l  r a   g  sedelaec gaa      l     t r           ae    ai  d 
               g  k        a                            k                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .        .                 ::   . .. :.:. .:..:  .*::        *   :   :
----tplhqdtrtggldfvke-tg-----------l-tmrdvvnefelkhsqayngmssrLhltpatadqsF-esvadev
tsiyaeqemtngqlldiayrth--mshykskrkqv-palkrsaaslvvryelvfkdllqq qiesqgeyvr vktimttm
elgsqa rs   eii a l sf  lppsdrgqhha s  tq  edvlm  qit  iah dqkpd m  isc  k l
    d  gr           n   fclq   n    a  ng  d iai                  a  l   g   e  
       d                   p   k                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *. .***** .*.:**. :.    :      *  :.. :: ** .  . *: .: .*  *.*:*    .       * 
FrDg-tNWGRIvsLfaFGaavcvecvekemspcVgtvaewissYLdnkqqdWllsnkgWegFvEfFgvddv-------En
 s ntv     cg vt  gvlssrqndlqrerl ssigqqmtv  lteirp iqnqga hr a i hkpataesrksq s
 n di      a  l    m  khlk rglgk  el  ke     ish    k         r ena        a
                                   n  d                         c             
                                                                                

       250       260       
....:....|....:....|....:..
  .  *  :   : .  .     .   
fkrwlLmgmtllagvgagllilqr---
vvkst vavvgvttivvasayaikrlv
am na avigsc  f g   lktnce 
 i                  f n    
                           
© 1998-2020Legal notice