Dataset for protein BCL-2-like of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671LEY4_MCL1-01      MTLSLVRRTAAVSLLGAHTALVPAAALKARSEDELDGCADEPDAAGKPVR
A0A671L9M9_MCL1-01      --------MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFSRKPLV-MPEL
A0A671RQ00_MCL1-01      --------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLV-MPER
A0A671LAP7_MCL1-01      --------------MTLSLGNRPMAALGVL-----AEEADAAL---KPLR
A0A671K7W7_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGND---DEAA
A0A671K7W7_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGND---DEAA
A0A671QPE4_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGND---DEEA
                                              *   :                       

A0A671LEY4_MCL1-01      PGANGLRGLQLDGRFVSAADGSLPSTPDPQELGSAELDRDTRQLLLDFYR
A0A671L9M9_MCL1-01      KAQNQFTGNGLQGSVPSSPETDCEEI-DDYTSIYAALEMDTREIIDAFLK
A0A671RQ00_MCL1-01      KPQNQFTGNGLQGSVPSSPKPDCEEVQDEYTSIYDALEMDTREIIDIFLK
A0A671LAP7_MCL1-01      PGTNGLKGLQLDGRFVSAGDGSLPATPDP-----QELGSDTRQLLLDFYR
A0A671K7W7_BCL2L1-      AGTTNLINGSLNGT-STGSTGTPPRSPTS-----TPQHQTNGTGGLDAVK
A0A671K7W7_BCL2L1-      AGTTNLINGSLNGT-STGSTGTPPRSPTS-----TPQHQTNGTGGLDAVK
A0A671QPE4_BCL2L1-      AGTTTLVNGSLNGT-STGSTGTPPRSPAS-----TPQRQTNGTGGLDAVK
                           . : .  *:*   :.                      .        .

A0A671LEY4_MCL1-01      THTGMCPQDRKQHHALPTMTQVVADILLKHEIAYKGMLQRLQLESQADDM
A0A671L9M9_MCL1-01      SFTGLSHYKSGKKQVLSTMKGVVDSLAVKHELAYKGMIARLNLEQKGEDV
A0A671RQ00_MCL1-01      NFTGFPHSKSGNKQVLATMNRVVESLVMKHELVYKGMIARLNLEQKGEDV
A0A671LAP7_MCL1-01      THTGMSLPDRKRHHALPTMKRVVADVVIKHQITYRGMLQHLQLDSQPDDL
A0A671K7W7_BCL2L1-      E----------------ALRDSANEFELRYSQAFNDLSSQLHITPATAYQ
A0A671K7W7_BCL2L1-      E----------------ALRDSANEFELRYSQAFNDLSSQLHITPATAYQ
A0A671QPE4_BCL2L1-      E----------------ALRDSANEFELRYSQAFNDLSSQLHITPATAYQ
                                         ::   . .. :.:. .:..:  .*::       

A0A671LEY4_MCL1-01      SFISCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQ
A0A671L9M9_MCL1-01      RFVKTVATELFSDGITNWGRICSLLTFGAMVCKHQNDRGLGKCVSLVGEE
A0A671RQ00_MCL1-01      SFVKTVATELFSDGITNWGRIASLLTFGAMVSKHQNDKGLSKCVSLVGKE
A0A671LAP7_MCL1-01      SFIGCIAKTMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQ
A0A671K7W7_BCL2L1-      SF-ESVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKEMSPLVGSIAEW
A0A671K7W7_BCL2L1-      SF-ESVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKEMSPLVGSIAEW
A0A671QPE4_BCL2L1-      SF-ESVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKEMSPLVGNIADW
                         *   :   :* *. .***** .*.:**. :.    :      *  :.. 

A0A671LEY4_MCL1-01      ISSYLISEQHDWLLNNKGWHGFVEFFCVEDV-------ESVIRNALMAVV
A0A671L9M9_MCL1-01      ISSYLLTDQRDWLLKNKAWDGFVEFFHVPDT-------EAAMRSTLMVIG
A0A671RQ00_MCL1-01      ISSYLLTTQRDWLLKNKAWDGFVEFFHVPNT-------EAAVRNTLMAIG
A0A671LAP7_MCL1-01      ISSYLISEQHDWLLNNKGWHGFVEFFRVEDV-------ESVVRSALMAVV
A0A671K7W7_BCL2L1-      MTVYLDNKIQPWIQSQGGWERFAEIFGKDAVAESRKSQENFKKWLLVGMT
A0A671K7W7_BCL2L1-      MTVYLDNKIQPWIQSQGGWERFAEIFGKDAVAESRKSQENFKKWLLVGMT
A0A671QPE4_BCL2L1-      MTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLAGMT
                        :: ** .  . *: .: .*  *.*:*    .       *   .  *  : 

A0A671LEY4_MCL1-01      GCAGIGAGLLFKNNCEV
A0A671L9M9_MCL1-01      GVATFGAALAYLIR---
A0A671RQ00_MCL1-01      SVATFGAALAYLTR---
A0A671LAP7_MCL1-01      GCAGIGAGLALLIR---
A0A671K7W7_BCL2L1-      LLTGVVVGSLIAQKRL-
A0A671K7W7_BCL2L1-      LLTGVVVGSLIAQKRL-
A0A671QPE4_BCL2L1-      LLTGVVGGSLIAQKRL-
                          : .  .     .   

© 1998-2020Legal notice