Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------dtrnlvadylgyklrqpgyg-g-----ag-g---ppgttl-------------------------------
mmmtdhsfqynhlqtqafirlv-yikq--w-qfsdv--s-gat-aakrsemetpsiissqpgwtpgpsppvnpvtrtxxx
 aaapaeapmige-rn-vv--nsscg-svts     eepvega -sgp-   a gafngn ahhladaaardgaaghsss
  h grtsg-f-ai--k--s - q-- asld       nttes e-dap                               
     pmqys-e-  v   h c -er  ec        drp     --e                               
      lg r  q  m   e                          ad                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------hqalraagdvfe-r-rrlfpdldsqlhvtpgtarqrf-qvveelfrd--g-pnwgriVa
xxxxxxxxxxxxxxspvppvvrvlqkv-fseqkt-yestksc-anvhiismdn-yt--t---------sp-iv----v-t
ldarevipm         aaila-m-et-a---evf--a-a-v-a-------srq-svstmsnkelqg    itarnl -
                     --w- -gs-qvsvlegk-y-vmt-syrly r- -gi er mda  e     -d   - r
                     kmvk t lrpr rgi ewr sisgmagg  pa vel a  a    s            m
                     alte q a d  l g  dg pfp a  a  f  l                         
                                 g       e g                                    
                                           f                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ffafggalc------------------vesvnkemaplvd---riaywmaeylntrlapwiqenggwd------------
i-v-eai--ergplvtarwkkwgfqsr-k-------vd-stykqvsefvvtfimnhtge-lrss----tfailygvrele
-psi---vi                  k-llreriq--cg   e-qa-l-a--edn-edp-hr-eapalwvsmsrnnams
pl- a vml                  a epdrdver  -   -t--r-t-ra---r-a  e-q   vketekmpmlved
l p   t                    l   eg  s   t   nlvsl ss  vrqhr-  -dm   gedna aleg aa
  e   e                                q   a pl  lf  pg  ht   a    ea      dd   
                                              g                                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------a-----------------
eyrkkqlslrrwvltqmtvvgvpgngsstdgslpstppvarsleeknyasvrtiyvgyvryg-tgakdtkpmgrsgaasr
gskpgpmrqqpefepllnmspp  hag           pimrirdgmwrqslsvltrnldlqtlrrrtwghfhtwesvn 
aqeeelkgknna  kg ela e                  eee  ele da e is a ae s aeeleag  gc gpa 
 ea  keef                                                                       
     d a                                                                        
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------l---------------------v-fgaffa-k----------
kaletlrrvgdlyqrnhetafqgmlrkldisneddvks-srvmvhvfsdgvtnwgrivtlitl--l--s-lktinqesci
wtilldklfvegvgpsmpktsrpgrpyfvfkwsssrwlsllttissvr        qik -s-ss-vsrh tqvipkrtn
vg fc cfsn  llngaaagagk qevmnvnslelktt tgmlerlc             klvkpylyks          
        l     a    e a  f rie  dk  irf  dli gg               i    iphq          
                          l         h   aad aa               d     ga           
                                                                                
                                                                                

       410       420       430       440       450       460       470   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
-------------------------------------------------------------------------
eplaesitdvlvrtkrdwlvkqrgwdgfveffhvedleggirnvllafagvagvgaglayliraratswyspy
r gisttdrgfp ar  yrarttnynssrsr                ys fnsrpr rv rg           
                                                                         
                                                                         
                                                                         
                                                                         
                                                                         
© 1998-2020Legal notice