Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------t-----dtrnlvndylgyklyq-g---------agsg-a-p--------------------------
hlsslpliaarmm-dheapyihlqtaavirlv-rik-yvlgqfsdvpqp-g-g-pgtrsemlapgakstqpgwtegpaap
          maaapasfgmfge-rq-fv--nnqcg agcs     ---vettasagdp  ettsiinsn mtrssdssa
            hmgrtsq-n-ai--k--sq- --r  swd     epnrtga a aal       fdrk ahppaapp 
              epmqys-k- qve ek m ss   e        ed nep e           c ge  ghl     
               elgerleq  m   h   m                                              
                   k         e                                                  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------ktlhqalraagdvfetrerrafsdldsqlhvtpgnartrfsqvmeelf-d--
vnpvtrtxxxxxxxxxxxxxxxxxspvpdpsrvlqkv-fseqkevyestkpcmanvhiismdtrqq--t--vdke-rgsp
rdgaaghsssldarevipm         ---latm-evsaqvsvlfgelgavirgsagayvpsgyksvarms---lq-  
                            grv---e -t--prrrggptwrqpyga----nnradvgil-te-nav eh  
                            taikmw- tglrgiqsni kme gvtrmyvlk fy lel ee lvhh s   
                            rvealvk r a d mlih  f  eas k dg  ed a      a        
                            pka e   q      k    d  a p i                        
                            a              g         l                          
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .:.                                                           :           
g-pnwgRiVaf----------fafggalc------------------kesvrkemap---lvkriqewmaeylntrladw
-iidarnvttlcdkfsghpkgpvieaiviergplvtarwkkwgfqsrvkllnerievdvdtygqvayfvvafimnntgep
 vvtvn l ri          lsyiefs-                  a--------s esditetssrlttvaerhrrai
 c-s     mp          ip a eml                  -hepdtsvqr   cfsalpasilfrrvdtpep 
  t      i            e   v d                  l  ktrnqsl    crprvll ssk pgqkh- 
  g                       t a                      eidl       qn  ik ip  t  h t 
                                                    g         eg  g   d         
                                                              d                 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                                                                          
irenggwda----------------------------ly-----------rpl-e------rt-ltgav--g--------
lqssrapatdaimspedeldwegpkrwglqnfvekqm--gpeplgeapav---f-gswasv--vyvvetgv-astdgslp
shrqe feetrrrtwvrmmte aealkeifllta   gvelgaankravylrrrpknnwnslllmsl-palrsl      
 etm   --e  kargg ge           ecl   fnsdymneasrtsqkgltvmvrwtswf-l-v-vhagv      
 vkd   vs                            nmhvslgamgkrimsienryivmrksiv- nssy  t      
 td    pr                             fdnpg   egkgkeftdnggsdlfrhfa mnii  f      
  a    gn                                nd     faga q ffel f mg   kld   c      
        l                                l      e           a ie   fic          
        k                                                      a   dg           
        g                                                           a           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------vilgrlfssk------------------------------------------------
stpppaeeeedelyrcgsvqslet-saylr-qatgakdtkpmgrsgaasrkaletlrrvgdgvqrnhetafqgwltqvdi
        l ahfhg    nrv--v-sfyqr-pk fayiefsdkesvrtsl  deslfr rqikvdfkafiyssvrkl  
                      tliklvsleyl                                        m cg   
                      rprcdmkayr                                                
                      qmk pkapih                                                
                      kkf ka ghg                                                
                      i       g                                                 
                              a                                                 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
knedivkstsrvmvsvtsrgvtrwgrivtlisfgafvryrlrttnyqscrsrfyssitsvpvrtvyrwrvrsrswygpyn
    dp rln pgihtpdd srna             akhak i qnksieplcrgfndrlrgrkrdglakqtg fsive
               lfc  fp                       he  aag aecc              a   d fs 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510   
....:....|....:....|....:....|...
                                 
---------------------------------
kihvedleggirnvllafagvagvgaglaylir
ffal                             
                                 
                                 
                                 
                                 
                                 
                                 
                                 
© 1998-2022Legal notice