Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------t-----dtrnlvndylgyklyq-g---------agsg-a-p--------------------------
hlsslpliaarmm-dheapyihlqtaavirlv-rik-yvlgqfsdvpqp-g-g-pgtrsemlapgakstqpgwtegpaap
          maaapasfgmfge-rq-fv--nnqcg agcs     ---vettaaagdp  ettsiinsn mtrssdssa
            hmgrtsq-n-ai--k--sq- --r  swd     epnrtga e aal       fdrk ahppaapp 
              epmqys-k- qve ek m ss   e        ed nep             c ge  ghl     
               elgerleq  m   h   m                                              
                   k         e                                                  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------sklhqalraagdevekryrrafspllgqlhi-tpgnartrfsqvmeelf-d-
vnpvtrtxxxxxxxxxxxxxxxxxspvpdptsrvmqkvafsfqtgveetlkdcadsvgvvsmdtrqq--t--vdke-rgs
rdgaaghsssldarevipm         ---lateketsaqrsvefgtsgavmgana-aiyvpsgyksvarms---lq- 
                            grv-----r----prrsgpsrwraivs--y-gnnradvgil-te-nav eh 
                            taiklmw -  lv imnli kmqgytrkmll k fy lel ee lvhh s  
                            rveae   q   r  lli  f eepsp idh   ed a      a       
                            p a         g    h  d   dr                          
                            a           d                                       
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .:.                                                           :          
-g-pnwgRiVaf----------fafggalc------------------kesvrkemap---lvkriqewmaeylntrlad
p-iidarnvttlcdkfsghpkgpvieaiviergplvtarwkkwgfqsrvkllnerievdvdtygqvayfvvafimnntge
  vvtvn l ri          lsyiefs-                  a--------s esditetssrlttvaerhrra
  c-s     mp          ip a eml                  -hepdtsvqr   cfsalpasilfrrvdtpep
   t      i            e   v d                  l  ktrnqsl    crprvll ssk pgqkh-
   g                       t a                      eidl       qn  ik ip  t  h t
                                                     g         eg  g   d        
                                                               d                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .                                                                         
wirenggwda----------------------------ly-----------rpl-e------rt-ltgav--g-------
plqssrapatdaimspedeldwegpkrwglqnfvekqm--gpeplgeapav---f-gswasv--vyvvetgv-astdgsl
ishrqe feetrrrtwvrmmte aealkeifllta   gvelgaankravylrrrpknnwnslllmsl-palrsl     
  etm   --e  kargg ge           ecl   fnsdymneasrtsqkgltvmvrwtswf-l-v-vhagv     
  vkd   vs                            nmhvslgamgkrimsienryivmrksiv- nssy  t     
  td    pr                             fdnpg   egkgkeftdnggsdlfrhfa mnii  f     
   a    gn                                nd     faga q ffel f mg   kld   c     
         l                                l      e           a ie   fic         
         k                                                      a   dg          
         g                                                           a          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------vilgrlfssk-----------------------------------------------
pstpppaeeeedelyrcgsvqslet-saylr-qatgakdtkpmgrsgaasrkaletlrrvgdgvqrnhetafqgwltqvd
         l ahfhg    nrv--v-sfyqr-pk fayiefsdkesvrtsl  deslfr rqikvdfkafiyssvrkl 
                       tliklvsleyl                                        m cg  
                       rprcdmkayr                                               
                       qmk pkapih                                               
                       kkf ka ghg                                               
                       i       g                                                
                               a                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
iknedivkstsrvmvsvtsrgvtrwgrivtlisfgafvryrlrttnyqscrsrfyssitsvpvrtvyrwrvrsrswygpy
     dp rln pgihtpdd srna             akhak i qnksieplcrgfndrlrgrkrdglakqtg fsiv
                lfc  fp                       he  aag aecc              a   d fs
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510    
....:....|....:....|....:....|....
                                  
----------------------------------
nkihvedleggirnvllafagvagvgaglaylir
effal                             
                                  
                                  
                                  
                                  
                                  
                                  
                                  
© 1998-2022Legal notice