Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      -------------MEEEAEKLKELQNEVEKQMNMS-----------PPPG
A0A2K6TLJ5_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
A0A2K6TLJ5_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
A0A2K6TLJ5_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5Y3_MCL1-01      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6V5Y3_MCL1-02      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6TIT7_BCL2L10      ------------MADPLQQRTEQLVADYLEY-------------------
A0A2K6UEL3_BCL2-01      ----------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDV
A0A2K6UWY8_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENR
A0A2K6TM77_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5Y3_MCL1-03      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      NAGP----------------------------------------------
A0A2K6TLJ5_BCL2A1-      -TGPS---------------------------------------------
A0A2K6TLJ5_BCL2A1-      -TGPS---------------------------------------------
A0A2K6TLJ5_BCL2A1-      -TGPS---------------------------------------------
A0A2K6TM77_BCL2L2-      EGPAA---------------------------------------------
A0A2K6TM77_BCL2L2-      EG-PAA--------------------------------------------
A0A2K6V5Y3_MCL1-01      GATPPG--------------------------------------------
A0A2K6V5Y3_MCL1-02      GATPPG--------------------------------------------
A0A2K6TIT7_BCL2L10      ----------------CSREPGTPESPPA---------------------
A0A2K6UEL3_BCL2-01      GAAPPGAAP---APGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXXXX
A0A2K6UWY8_BCL2L1-      TEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREVIPM-
A0A2K6TM77_BCL2L2-      ------------------------EGPAA---------------------
A0A2K6V5Y3_MCL1-03      GATPPGGRL--LATGAKDTKPMGRSGAAS---------------------
                                                                          

A0A2K6UWY8_BCL2L1-      ------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQ
A0A2K6TM77_BCL2L2-      --------------------VIMSIEEKMEADARSIYVGNVDYGAT--AE
A0A2K6TLJ5_BCL2A1-      --------KTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQ
A0A2K6TLJ5_BCL2A1-      --------KTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQ
A0A2K6TLJ5_BCL2A1-      --------KTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQ
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
A0A2K6V5Y3_MCL1-01      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAGASPPAALT----
A0A2K6V5Y3_MCL1-02      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAGASPPAALT----
A0A2K6TIT7_BCL2L10      --------TAEAAVLRATAAVVRKLYPSFFSAYRG----YPRNRVELVAR
A0A2K6UEL3_BCL2-01      XXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFAT
A0A2K6UWY8_BCL2L1-      --------AAIKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQ
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
A0A2K6V5Y3_MCL1-03      --------RKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSR
                                                                          

A0A2K6UWY8_BCL2L1-      VVNELFRD--GV-NWGRIVAF----------FSFGGALC-----------
A0A2K6TM77_BCL2L2-      ELEAHF-H--GCGSVNRVTILCDKFSGHPKGFAYIEFSD-----------
A0A2K6TLJ5_BCL2A1-      VMEKEFED--GIINWGRIVTI----------FAFEGILI-----------
A0A2K6TLJ5_BCL2A1-      VMEKEFED--GIINWGRIVTI----------FAFEGILI-----------
A0A2K6TLJ5_BCL2A1-      VMEKEFED--GIINWGRIVTI----------FAFEGILI-----------
A0A2K6TM77_BCL2L2-      VSDELFQG--G-PNWGRLVAF----------FVFGAALC-----------
A0A2K6TM77_BCL2L2-      VSDELFQG--G-PNWGRLVAF----------FVFGAALC-----------
A0A2K6V5Y3_MCL1-01      ------------PDARRVVRP----------PPIGAEV------------
A0A2K6V5Y3_MCL1-02      ------------PDARRVVRP----------PPIGAEV------------
A0A2K6TIT7_BCL2L10      MAEALLSDSPG-PTWGNVVML----------LAFAGTLLERGPLVTARWK
A0A2K6UEL3_BCL2-01      VVEELFRD--G-VNWGRIVAF----------FEFGGVMC-----------
A0A2K6UWY8_BCL2L1-      VVNELFRD--G-VNWGRIVAF----------FSFGGALC-----------
A0A2K6TM77_BCL2L2-      VSDELFQG--G-PNWGRLVAF----------FVFGAALC-----------
A0A2K6V5Y3_MCL1-03      VMVHVFSD--GVTNWGRIVTL----------ISFGAFVA-----------
                                        .:.                               

A0A2K6UWY8_BCL2L1-      -------VESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDT-
A0A2K6TM77_BCL2L2-      -------KESVRTSLALDESLFRGRQIKVIPKRTNRPG-ISTTDRGFPR-
A0A2K6TLJ5_BCL2A1-      -------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWEN-
A0A2K6TLJ5_BCL2A1-      -------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGK-
A0A2K6TLJ5_BCL2A1-      -------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGW---
A0A2K6TM77_BCL2L2-      -------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE-
A0A2K6TM77_BCL2L2-      -------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWELE
A0A2K6V5Y3_MCL1-01      ----------------P---DVTATPSRLLFFAPTRRAAPLEEMEAPAAD
A0A2K6V5Y3_MCL1-02      ----------------P---DVTATPSRLLFFAPTRRAAPLEEMEAPAAD
A0A2K6TIT7_BCL2L10      KWGFQSRLKEPEGDVAR---DCQRLVGLLSSRLVGQHRAWLEAQGGWVST
A0A2K6UEL3_BCL2-01      -------VESVNREMSP---LVDNIALWMTEYLNRHLHTWIQDNGGWDA-
A0A2K6UWY8_BCL2L1-      -------VESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDT-
A0A2K6TM77_BCL2L2-      -------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE-
A0A2K6V5Y3_MCL1-03      -------KHLKTINQES---CIEPLAESITDVLVRTKRDWLVKQRGWDG-
                                                    :                .    

A0A2K6UWY8_BCL2L1-      ---------------------------FVELYGNNAAAESRKGQERFNRW
A0A2K6TM77_BCL2L2-      -------------------------------------ARYRARTTNYNSS
A0A2K6TLJ5_BCL2A1-      -------------------------------------GFVKKFEPKSGWM
A0A2K6TLJ5_BCL2A1-      ------------------------------------------------WN
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      ---------------------FTA---LYGDGALEEA---RRLREGNWAS
A0A2K6TM77_BCL2L2-      AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
A0A2K6V5Y3_MCL1-01      AIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE-----
A0A2K6V5Y3_MCL1-02      AIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE-----
A0A2K6TIT7_BCL2L10      RRRTWGGMGTWEGPARWGIFLLCL---LNDLLLAGMEKTAGPGFPVMVVN
A0A2K6UEL3_BCL2-01      ---------------------FVE---LYGPSM-------RPLFDFSWLS
A0A2K6UWY8_BCL2L1-      ---------------------FVE---LYGNNAAAESRKGQERFN-----
A0A2K6TM77_BCL2L2-      ---------------------FTA---LYGDGALEEA---RRLREGNWAS
A0A2K6V5Y3_MCL1-03      ---------------------FVE---FFHVEDL----------EGGIRN
                                                                          

A0A2K6UWY8_BCL2L1-      FLTGMTVAGV--------------------------------VLLGSLFS
A0A2K6TM77_BCL2L2-      RSRFYSGFNS--------------------------------RPRGRVYR
A0A2K6TLJ5_BCL2A1-      TFLEVTGKIC--------------------------------EMLSLLKQ
A0A2K6TLJ5_BCL2A1-      SLMLMLVESA--------------------------------QKKKKMAL
A0A2K6TLJ5_BCL2A1-      ----------------------------------------------DLSQ
A0A2K6TM77_BCL2L2-      VRTVLTGAVALGAL----------------------------VTVGAFFA
A0A2K6TM77_BCL2L2-      ARSIYVGNVDYGAT-----------AEELEAHFHGCGSVNRVTILCDKFS
A0A2K6V5Y3_MCL1-01      ----LVGEPGHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLR
A0A2K6V5Y3_MCL1-02      ----LVGEPGHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLR
A0A2K6TIT7_BCL2L10      SSIHLLLDTIIRSF----------------------------KIFSPLLP
A0A2K6UEL3_BCL2-01      LKTLLSLAL-VGAC----------------------------ITLGAYLG
A0A2K6UWY8_BCL2L1-      -RWFLTGMT-VAGV----------------------------VLLGSLFS
A0A2K6TM77_BCL2L2-      VRTVLTGAVALGAL----------------------------VTVGAFFA
A0A2K6V5Y3_MCL1-03      VLLAFAGVAGVGA--------------------------------GLAYL
                                                                          

A0A2K6UWY8_BCL2L1-      RK------------------------------------------------
A0A2K6TM77_BCL2L2-      SG------------------------------------------------
A0A2K6TLJ5_BCL2A1-      YY------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      SK------------------------------------------------
A0A2K6TM77_BCL2L2-      GHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQV--
A0A2K6V5Y3_MCL1-01      EQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
A0A2K6V5Y3_MCL1-02      EQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV--
A0A2K6TIT7_BCL2L10      AQL-----------------------------------------------
A0A2K6UEL3_BCL2-01      HK------------------------------------------------
A0A2K6UWY8_BCL2L1-      RK------------------------------------------------
A0A2K6TM77_BCL2L2-      SK------------------------------------------------
A0A2K6V5Y3_MCL1-03      IR------------------------------------------------
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      ----IPKRTNRPGISTTDRGFPRA-------------RYRARTTNYNSSR
A0A2K6V5Y3_MCL1-01      KNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCI
A0A2K6V5Y3_MCL1-02      ---------------LPCRGSRRW---------------------HQKCA
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      SRFYSGFNSRPRGRVYRGRARATSWYSPY---------------------
A0A2K6V5Y3_MCL1-01      EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAG
A0A2K6V5Y3_MCL1-02      AGFCRCC----------W---SRSWFGISNKIAL----------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6UWY8_BCL2L1-      -------------
A0A2K6TM77_BCL2L2-      -------------
A0A2K6TLJ5_BCL2A1-      -------------
A0A2K6TLJ5_BCL2A1-      -------------
A0A2K6TLJ5_BCL2A1-      -------------
A0A2K6TM77_BCL2L2-      -------------
A0A2K6TM77_BCL2L2-      -------------
A0A2K6V5Y3_MCL1-01      VAGVGAGLAYLIR
A0A2K6V5Y3_MCL1-02      -------------
A0A2K6TIT7_BCL2L10      -------------
A0A2K6UEL3_BCL2-01      -------------
A0A2K6UWY8_BCL2L1-      -------------
A0A2K6TM77_BCL2L2-      -------------
A0A2K6V5Y3_MCL1-03      -------------
                                     

© 1998-2020Legal notice