Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --MTDHEFGYIHNLTQDYLRYVLQIPQSGTG-------------PSKTS-
A0A2K6TLJ5_BCL2A1-      --MTDHEFGYIHNLTQDYLRYVLQIPQSGTG-------------PSKTS-
A0A2K6TIT7_BCL2L10      --MADPLQQRTEQLVADYLEYCSREPG------------TPESPPATAE-
A0A2K6UEL3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDVGAAPPGAAP-
A0A2K6UWY8_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSE
A0A2K6V5Y3_MCL1-03      ---------MFGLQRNAVIGLNLYCGGAGLG-----AGSGGATPPGGRL-
A0A2K6TM77_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPGEG-PAADPL-
A0A2K6TM77_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPGEG-PAADPL-
A0A2K6V5Y3_MCL1-01      ---------MFGLQRNAVIGLNLYCGGAGLG-----AGSGGATPPGGRL-
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --APGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXXXXXXXXSPVPPV
A0A2K6UWY8_BCL2L1-      METPSAINGNPAWHLADSPAVNGATGHSSSLDAREVIPM---------AA
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
                                                                          

A0A2K6UWY8_BCL2L1-      --MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRD--
A0A2K6TLJ5_BCL2A1-      -RVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFED--
A0A2K6TLJ5_BCL2A1-      -RVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFED--
A0A2K6TIT7_BCL2L10      -AAVLRATAAVV----RKLYPSFFSAYRGYPRNRVELVARMAEALLSDSP
A0A2K6UEL3_BCL2-01      VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD--
A0A2K6UWY8_BCL2L1-      IKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRD--
A0A2K6V5Y3_MCL1-03      -L------------------------------------------------
A0A2K6TM77_BCL2L2-      -HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--
A0A2K6TM77_BCL2L2-      -HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--
A0A2K6V5Y3_MCL1-01      -LAAEKEASAQREVGGGEAGAVIGGSAGASPPAALT--------------
                                                                          

A0A2K6UWY8_BCL2L1-      G-VNWGRIVAFFSFGGALC------------------VESVDKEMQVLVS
A0A2K6TLJ5_BCL2A1-      GIINWGRIVTIFAFEGILI------------------KKLLRERIAPDVD
A0A2K6TLJ5_BCL2A1-      GIINWGRIVTIFAFEGILI------------------KKLLRERIAPDVD
A0A2K6TIT7_BCL2L10      G-PTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQ
A0A2K6UEL3_BCL2-01      G-VNWGRIVAFFEFGGVMC------------------VESVNREMSPLVD
A0A2K6UWY8_BCL2L1-      G-VNWGRIVAFFSFGGALC------------------VESVDKEMQVLVS
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6TM77_BCL2L2-      G-PNWGRLVAFFVFGAALC------------------AESVNKEMEPLVG
A0A2K6TM77_BCL2L2-      G-PNWGRLVAFFVFGAALC------------------AESVNKEMEPLVG
A0A2K6V5Y3_MCL1-01      --PDARRVVRPPPIGAEV----------------------------PDVT
                                                                          

A0A2K6UWY8_BCL2L1-      ---RIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN
A0A2K6TLJ5_BCL2A1-      TYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLMLVESAQKKKKMAL-
A0A2K6TLJ5_BCL2A1-      TYKEISYFVAEFIMNNTGEWIRRNGGW------------------DLSQ-
A0A2K6TIT7_BCL2L10      ---RLVGLLSSRLVGQHRAWLEAQGGWV----------------------
A0A2K6UEL3_BCL2-01      ---NIALWMTEYLNRHLHTWIQDNGGWD----------------------
A0A2K6UWY8_BCL2L1-      ---RIAAWMATYLNDHLEPWIQENGGWD----------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6TM77_BCL2L2-      ---QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEE---------
A0A2K6TM77_BCL2L2-      ---QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQ
A0A2K6V5Y3_MCL1-01      ---ATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEDELDGYEPEPLGKR
                                                                          

A0A2K6UWY8_BCL2L1-      RWFLTGMTVAGV--------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6TM77_BCL2L2-      -----------------------------ARRLREGNWASVRTVLTGAVA
A0A2K6TM77_BCL2L2-      NEVEKQMNMSPPPGNAG----------PVIMSIEEKMEADARSIYVGNVD
A0A2K6V5Y3_MCL1-01      PAVLPLLELVGEPGHGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLR
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --STRRRTWGGMGTWEGPARWGIFLLCLLNDLLLAGMEKTAGPGFPVMVV
A0A2K6UEL3_BCL2-01      --A-------------------------FVELYGPSM-------RPLFDF
A0A2K6UWY8_BCL2L1-      --T-------------------------FVELYGNNAAAESRKGQERFN-
A0A2K6V5Y3_MCL1-03      --ATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
A0A2K6TM77_BCL2L2-      LGAL----------------------------------------------
A0A2K6TM77_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSG------HPKGFA----YIEF
A0A2K6V5Y3_MCL1-01      EQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
                                                                          

A0A2K6UWY8_BCL2L1-      ------------------------------VLLGSLFSRK----------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TIT7_BCL2L10      NSS--IHLLLDTIIRSF-------------KIFSPLLPAQL---------
A0A2K6UEL3_BCL2-01      SWLSLKTLLSLALVGAC-------------ITLGAYLGHK----------
A0A2K6UWY8_BCL2L1-      -----RWFLTGMTVAGV-------------VLLGSLFSRK----------
A0A2K6V5Y3_MCL1-03      KNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCI
A0A2K6TM77_BCL2L2-      ------------------------------VTVGAFFASK----------
A0A2K6TM77_BCL2L2-      SDKESVRTSLALDESLFR------GRQIK-VDFKAFIYSSLTQVIPKRTN
A0A2K6V5Y3_MCL1-01      KNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCI
                                                                          

A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAG
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      RPGISTTDRGFPRAR--YRARTTNYNSSRSRF---------------YSG
A0A2K6V5Y3_MCL1-01      EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAG
                                                                          

A0A2K6UWY8_BCL2L1-      -----------------------
A0A2K6TLJ5_BCL2A1-      -----------------------
A0A2K6TLJ5_BCL2A1-      -----------------------
A0A2K6TIT7_BCL2L10      -----------------------
A0A2K6UEL3_BCL2-01      -----------------------
A0A2K6UWY8_BCL2L1-      -----------------------
A0A2K6V5Y3_MCL1-03      VAGVGAGLAYLIR----------
A0A2K6TM77_BCL2L2-      -----------------------
A0A2K6TM77_BCL2L2-      FNSRPRGRVYRGRARATSWYSPY
A0A2K6V5Y3_MCL1-01      VAGVGAGLAYLIR----------
                                               

© 1998-2020Legal notice