Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5X4_MCL1-02      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6V5X4_MCL1-01      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6TIT7_BCL2L10      ------------MADPLQQRTEQLVADYLEY-------------------
A0A2K6UEL3_BCL2-01      ----------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDV
A0A2K6UWY8_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENR
A0A2K6TM77_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5X4_MCL1-03      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      -------------MEEEAEKLKELQNEVEKQMNMS-----------PPPG
A0A2K6TLG6_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
A0A2K6TLG6_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
A0A2K6TLG6_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQI-----------PQSG
                                                                          

A0A2K6TM77_BCL2L2-      EGPAA---------------------------------------------
A0A2K6TM77_BCL2L2-      EG-PAA--------------------------------------------
A0A2K6V5X4_MCL1-02      GATPPG--------------------------------------------
A0A2K6V5X4_MCL1-01      GATPPG--------------------------------------------
A0A2K6TIT7_BCL2L10      ----------------CSREPGTPESPPA---------------------
A0A2K6UEL3_BCL2-01      GAAPPGAAP---APGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXXXX
A0A2K6UWY8_BCL2L1-      TEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREVIPM-
A0A2K6TM77_BCL2L2-      ------------------------EGPAA---------------------
A0A2K6V5X4_MCL1-03      GATPPGGRL--LATGAKDTKPMGRSGAAS---------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      NAGP----------------------------------------------
A0A2K6TLG6_BCL2A1-      -TGP----------------------------------------------
A0A2K6TLG6_BCL2A1-      -TGP----------------------------------------------
A0A2K6TLG6_BCL2A1-      -TGP----------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHV-TPGSAQQRFT
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHV-TPGSAQQRFT
A0A2K6V5X4_MCL1-02      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAGA-SPPAALT---
A0A2K6V5X4_MCL1-01      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAGA-SPPAALT---
A0A2K6TIT7_BCL2L10      --------TAEAAVLRATAAVVRKLYPSFFSAYRG-----YPRNRVELVA
A0A2K6UEL3_BCL2-01      XXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHL-TPFTARGRFA
A0A2K6UWY8_BCL2L1-      --------AAIKQALREAGDEFELRYRRAFSDLTSQLHI-TPGTAYQSFE
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHV-TPGSAQQRFT
A0A2K6V5X4_MCL1-03      --------RKALETLRRVGDGVQRNHETAFQGMLRKLDI-KNEDDVKSLS
A0A2K6UWY8_BCL2L1-      -------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFE
A0A2K6TM77_BCL2L2-      ---------------------VIMSIEEKMEADARSIYVGNVDYGAT--A
A0A2K6TLG6_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
A0A2K6TLG6_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
A0A2K6TLG6_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
                                                                          

A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAF----------FVFGAALC----------
A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAF----------FVFGAALC----------
A0A2K6V5X4_MCL1-02      -------------PDARRVVRP----------PPIGAEV-----------
A0A2K6V5X4_MCL1-01      -------------PDARRVVRP----------PPIGAEV-----------
A0A2K6TIT7_BCL2L10      RMAEALLSDSPG-PTWGNVVML----------LAFAGTLLERGPLVTARW
A0A2K6UEL3_BCL2-01      TVVEELFRD--G-VNWGRIVAF----------FEFGGVMC----------
A0A2K6UWY8_BCL2L1-      QVVNELFRD--G-VNWGRIVAF----------FSFGGALC----------
A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAF----------FVFGAALC----------
A0A2K6V5X4_MCL1-03      RVMVHVFSD--GVTNWGRIVTL----------ISFGAFVA----------
A0A2K6UWY8_BCL2L1-      QVVNELFRD--GV-NWGRIVAF----------FSFGGALC----------
A0A2K6TM77_BCL2L2-      EELEAHF-H--GCGSVNRVTILCDKFSGHPKGFAYIEFSD----------
A0A2K6TLG6_BCL2A1-      QVMEKEFED--GIINWGRIVTI----------FAFEGILI----------
A0A2K6TLG6_BCL2A1-      QVMEKEFED--GIINWGRIVTI----------FAFEGILI----------
A0A2K6TLG6_BCL2A1-      QVMEKEFED--GIINWGRIVTI----------FAFEGILI----------
                                         .:.                              

A0A2K6TM77_BCL2L2-      --------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE
A0A2K6TM77_BCL2L2-      --------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWEL
A0A2K6V5X4_MCL1-02      -----------------P---DVTATPSRLLFFAPTRRAAPLEEMEAPAA
A0A2K6V5X4_MCL1-01      -----------------P---DVTATPSRLLFFAPTRRAAPLEEMEAPAA
A0A2K6TIT7_BCL2L10      KKWGFQSRLKEPEGDVAR---DCQRLVGLLSSRLVGQHRAWLEAQGGWVS
A0A2K6UEL3_BCL2-01      --------VESVNREMSP---LVDNIALWMTEYLNRHLHTWIQDNGGWDA
A0A2K6UWY8_BCL2L1-      --------VESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDT
A0A2K6TM77_BCL2L2-      --------AESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE
A0A2K6V5X4_MCL1-03      --------KHLKTINQES---CIEPLAESITDVLVRTKRDWLVKQRGWDG
A0A2K6UWY8_BCL2L1-      --------VESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDT
A0A2K6TM77_BCL2L2-      --------KESVRTSLALDESLFRGRQIKVIPKRTNRPG-ISTTDRGFPR
A0A2K6TLG6_BCL2A1-      --------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWEN
A0A2K6TLG6_BCL2A1-      --------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGK
A0A2K6TLG6_BCL2A1-      --------KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGW--
                                                     :                .   

A0A2K6TM77_BCL2L2-      ----------------------FTA---LYGDGALEEA---RRLREGNWA
A0A2K6TM77_BCL2L2-      EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
A0A2K6V5X4_MCL1-02      DAIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE----
A0A2K6V5X4_MCL1-01      DAIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE----
A0A2K6TIT7_BCL2L10      TRRRTWGGMGTWEGPARWGIFLLCL---LNDLLLAGMEKTAGPGFPVMVV
A0A2K6UEL3_BCL2-01      ----------------------FVE---LYGPSM-------RPLFDFSWL
A0A2K6UWY8_BCL2L1-      ----------------------FVE---LYGNNAAAESRKGQERFN----
A0A2K6TM77_BCL2L2-      ----------------------FTA---LYGDGALEEA---RRLREGNWA
A0A2K6V5X4_MCL1-03      ----------------------FVE---FFHVEDL----------EGGIR
A0A2K6UWY8_BCL2L1-      ----------------------------FVELYGNNAAAESRKGQERFNR
A0A2K6TM77_BCL2L2-      --------------------------------------ARYRARTTNYNS
A0A2K6TLG6_BCL2A1-      --------------------------------------GFVKKFEPKSGW
A0A2K6TLG6_BCL2A1-      -------------------------------------------------W
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      SVRTVLTGAVALGAL----------------------------VTVGAFF
A0A2K6TM77_BCL2L2-      DARSIYVGNVDYGAT-----------AEELEAHFHGCGSVNRVTILCDKF
A0A2K6V5X4_MCL1-02      -----LVGEPGHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYL
A0A2K6V5X4_MCL1-01      -----LVGEPGHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYL
A0A2K6TIT7_BCL2L10      NSSIHLLLDTIIRSF----------------------------KIFSPLL
A0A2K6UEL3_BCL2-01      SLKTLLSLAL-VGAC----------------------------ITLGAYL
A0A2K6UWY8_BCL2L1-      --RWFLTGMT-VAGV----------------------------VLLGSLF
A0A2K6TM77_BCL2L2-      SVRTVLTGAVALGAL----------------------------VTVGAFF
A0A2K6V5X4_MCL1-03      NVLLAFAGVAGVGA--------------------------------GLAY
A0A2K6UWY8_BCL2L1-      WFLTGMTVAGV--------------------------------VLLGSLF
A0A2K6TM77_BCL2L2-      SRSRFYSGFNS--------------------------------RPRGRVY
A0A2K6TLG6_BCL2A1-      MTFLEVTGKIC--------------------------------EMLSLLK
A0A2K6TLG6_BCL2A1-      NSLMLMLVESA--------------------------------QKKKKMA
A0A2K6TLG6_BCL2A1-      -----------------------------------------------DLS
                                                                          

A0A2K6TM77_BCL2L2-      ASK-----------------------------------------------
A0A2K6TM77_BCL2L2-      SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQV-
A0A2K6V5X4_MCL1-02      REQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV-
A0A2K6V5X4_MCL1-01      REQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLD
A0A2K6TIT7_BCL2L10      PAQL----------------------------------------------
A0A2K6UEL3_BCL2-01      GHK-----------------------------------------------
A0A2K6UWY8_BCL2L1-      SRK-----------------------------------------------
A0A2K6TM77_BCL2L2-      ASK-----------------------------------------------
A0A2K6V5X4_MCL1-03      LIR-----------------------------------------------
A0A2K6UWY8_BCL2L1-      SRK-----------------------------------------------
A0A2K6TM77_BCL2L2-      RSG-----------------------------------------------
A0A2K6TLG6_BCL2A1-      QYY-----------------------------------------------
A0A2K6TLG6_BCL2A1-      L-------------------------------------------------
A0A2K6TLG6_BCL2A1-      Q-------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      -----IPKRTNRPGISTTDRGFPRA-------------RYRARTTNYNSS
A0A2K6V5X4_MCL1-02      ----------------LPCRGSRRW---------------------HQKC
A0A2K6V5X4_MCL1-01      IKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESC
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5X4_MCL1-03      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      RSRFYSGFNSRPRGRVYRGRARATSWYSPY--------------------
A0A2K6V5X4_MCL1-02      AAGFCRCC----------W---SRSWFGISNKIAL---------------
A0A2K6V5X4_MCL1-01      IEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFA
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5X4_MCL1-03      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
A0A2K6TLG6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------
A0A2K6TM77_BCL2L2-      --------------
A0A2K6V5X4_MCL1-02      --------------
A0A2K6V5X4_MCL1-01      GVAGVGAGLAYLIR
A0A2K6TIT7_BCL2L10      --------------
A0A2K6UEL3_BCL2-01      --------------
A0A2K6UWY8_BCL2L1-      --------------
A0A2K6TM77_BCL2L2-      --------------
A0A2K6V5X4_MCL1-03      --------------
A0A2K6UWY8_BCL2L1-      --------------
A0A2K6TM77_BCL2L2-      --------------
A0A2K6TLG6_BCL2A1-      --------------
A0A2K6TLG6_BCL2A1-      --------------
A0A2K6TLG6_BCL2A1-      --------------
                                      

© 1998-2022Legal notice