Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :  *   . *  :: ::  :. .  . **.  .: : * * . .:   :. :  * .:* *::*   *... 
matpasapdtrAlvadfLgyklrqkgyvcgagpgeGPaadplhqaMrAagdef---etrfrrTfsdLaAqlHvtpGsaqq
-------meee eklke qnevekqmnmspppgna  vimsieek e darsiyvgnvdyga aee e hf --- cgsv
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. . :  : *.* *   . .*:: *.   .. :     *.*.   * .::.   .* .                      
rftqvsdelFqGgPnwgrlvAffvFgaalcaesvnkemEpLvgqvQewmvayletRladwihssggwa------------
nrvtilcdk s h ---kgf yie sdkesvrtslald s frgr ikvipkrtn pg----------leaikarvreme
                                                                   e            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsg
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            :  . *      * *  *: * *: : ...      
-----------------------------------------eftstygrGfpreryRlRttNynSvRtvlysgv------
hpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnr--ialtdd aleaar a eg wa s srftgafnsrprg
                                         pg                                     

       330      
....:....|....:.
 .  .           
-vyralvtvgaffask
ralgsr----------
    ggaratswyspy
© 1998-2022Legal notice