Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
matpasapdtralvadflgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft
--------------------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             ***
qvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssggwa-eftalygdgmlEEA
-----------------------------------------------------------------l---------ae   
                                                                e  aikarvre     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .*.*               ** ..*            *:: .* *  ** .                            
rrLrE---------------GNwgsV------------RtvyvGnVdyGAtvtv--------------------------
ek k lqnevekqmnmsppp  aap imsieekmeada silt a al  laeeleahfhgcgsvnrvtilcdkfsghpk
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            * .:
----------------------------------------------------------------------------Grvy
gfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrpr aff
                                                                                

       330   
....:....|...
 .           
rsk----------
agraratswyspy
  g          
© 1998-2022Legal notice