Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                          

A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A2K6RW35_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A2K6RW35_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                          

A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
A0A2K6RW35_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFTA
A0A2K6RW35_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFTA
                                                                          

A0A2K6RW35_BCL2L2-      -----MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A2K6RW35_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A2K6RW35_BCL2L2-      LYGDGALEEARRLRE---------------GNWASV------------RT
A0A2K6RW35_BCL2L2-      LYGDGALEEARRLRE---------------GNWASV------------RT
                               *** .*.*               ** ..*            *:

A0A2K6RW35_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A2K6RW35_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A2K6RW35_BCL2L2-      VLTGAVALGALVTV------------------------------------
A0A2K6RW35_BCL2L2-      VLTGAVALGALVTV------------------------------------
                        : .* *  ** .                                      

A0A2K6RW35_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A2K6RW35_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6RW35_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRSG----------
A0A2K6RW35_BCL2L2-      ----------------GAFFASK----------
A0A2K6RW35_BCL2L2-      ----------------GAFFASK----------
                                        * .: .           

© 1998-2022Legal notice