Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A2K6RW35_BCL2L2-      MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A2K6RW35_BCL2L2-      -------MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADA
                                :  *   . *  :: ::  :. .  . **.  .: : * * .

A0A2K6RW35_BCL2L2-      DEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
A0A2K6RW35_BCL2L2-      DEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
A0A2K6RW35_BCL2L2-      DEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
A0A2K6RW35_BCL2L2-      RSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---KGF
                         .:   :. :  * .:* *::*   *... . . :  : *.* *   . .

A0A2K6RW35_BCL2L2-      AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELE
A0A2K6RW35_BCL2L2-      AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA--
A0A2K6RW35_BCL2L2-      AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA--
A0A2K6RW35_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG------------
                        *:: *.   .. :     *.*.   * .::.   .* .            

A0A2K6RW35_BCL2L2-      AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEF
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      SDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
A0A2K6RW35_BCL2L2-      -------------------------------EFTALYGDGALEEARRLRE
A0A2K6RW35_BCL2L2-      -------------------------------EFTALYGDGALEEARRLRE
A0A2K6RW35_BCL2L2-      ---------------------------------ISTTDRGFPRARYRART
                                                          :  . *      * * 

A0A2K6RW35_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A2K6RW35_BCL2L2-      GNWASVRTVLTGAV-------ALGALVTVGAFFASK
A0A2K6RW35_BCL2L2-      GNWASVRTVLTGAV-------ALGALVTVGAFFASK
A0A2K6RW35_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                         *: * *: : ...       .  .           

© 1998-2022Legal notice