Dataset for protein Bcl-w of organism Rhinolophus ferrumequinum

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : * .*.  *    .. ::  .. **.  . *   .  . * *          :*.      .: ... ..
MAtpAsApttrAlvAggvGykprrrryvvpggpGEgpegdPlhqgmygnGlE----------lEtrprrtpselpprprv
  aa a adaa ga dfr sglgqkghlcgaag  agaaa ggaadraa d seelepgellf pefepefedeaaqlha

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.**:.              **. *        **. . *. ::    * :*  * :::                    **
tPGsp--------------GPnwGs-------GAplsqEsvnk----EsePlvGqvqe-------------------wEL
p  aaqqrftqvsdelfqg  gp rlvaffvf  agca eeeepglv md gd aiedwmvayletrladwihssggp  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVN
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
                                                                                

       330       340       
....:....|....:....|....:..
***************************
FYSGFNSRPRGRVYRGRARATSWYSPY
                           
© 1998-2020Legal notice