Dataset for protein Bcl-w of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671DWB3_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A671DWB3_BCL2L2-      MAAAAAAATAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
                        **:.*:*. : * .*.  *    .. ::  .. **.  . *   .  . *

A0A671DWB3_BCL2L2-      DE----------FETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG
A0A671DWB3_BCL2L2-      LESEELEPGELLLEPEPEPEPEEEPPRPRAPPGAP--------------G
                         *          :*.      .: ... ...**:.              *

A0A671DWB3_BCL2L2-      PNWGRLVAFFVFGAALCAESVNK----EMEPLVGQVQEWMVAYLETRLAD
A0A671DWB3_BCL2L2-      PGPGS-------GAPGSQEEEEEPGLVESDPGDGAIED------------
                        *. *        **. . *. ::    * :*  * :::            

A0A671DWB3_BCL2L2-      WIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A671DWB3_BCL2L2-      -------PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
                                ******************************************

A0A671DWB3_BCL2L2-      IMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFS
A0A671DWB3_BCL2L2-      IMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFS
                        **************************************************

A0A671DWB3_BCL2L2-      GHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDR
A0A671DWB3_BCL2L2-      GHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDR
                        **************************************************

A0A671DWB3_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A671DWB3_BCL2L2-      GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                        ***********************************************

© 1998-2020Legal notice