Dataset for protein Mcl-1 of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                            ::   ** * :*       :
mesaaislfah-g-----------kicat-fhgllagr-v--gilihggagwnflwgsrsssaqt  - aa althvqvn
         mvrlmrvsprvvyys-yp--d--------l-sf---lsrkw      pklk  mag    e     dfvp 
         cn agmmplnkmsfdqldr  r drgle     vwef aap      ea                      
             fg gfkeghea                                                        

        90       100       110       120       130       140       150       160
                                 *  :*  :: .* ..:         :. .  *: ***:*:: **.:.
fisisstkeqttislcdgevtvlikpkp-ervr eed lcligg lrgf--ls-rsgnhhgasd lr   d mlh  eva
                         ---  gsa   rr         i   qkt d    hg m      vil   i 

       170       180       190       200       210       220       230       240
*.**. ** :*:..*.* :* :*** **.** *********:*:*****:. :: ** :**. * * ** ** :**.:**
 s  fq  cl dqd d ef rs   e  n  t         l l     eqmkea  eh  el g e  t  ls  kd  
 n                          d                     wl  v              m          

       250       260       270       280    
::****.******.  *.**.:******:.  **:****.** *
ik    d      hed p  km      faga  l    a  m 
© 1998-2022Legal notice