Dataset for protein Mcl-1 of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4C6H5_MCL1-01      --LFSFVWEFSRKWPWNF-----------------LWEK-----------
A0A3B4C6H5_MCL1-03      MMMSPKEMYFDKKTVFPS-----------------LLAKRPFTLGISSQT
A0A3B4CGU9_MCL1-03      MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEG-------LQAAP
A0A3B4CGU9_MCL1-02      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
                                                           :              

A0A3B4C6H5_MCL1-01      ---LIAAVTDGSLPTSPASDCEELDS------------------------
A0A3B4C6H5_MCL1-03      RAPRIAAVTDGSLPTSPASDCEELDS------------------------
A0A3B4CGU9_MCL1-03      GPASKAAMAGGSLPESPESDDFVPDF------------------------
A0A3B4CGU9_MCL1-02      GGSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEVTVLIK
                             ::   ** * :*       :                         

A0A3B4C6H5_MCL1-01      DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVVDGLVV
A0A3B4C6H5_MCL1-03      DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVVDGLVV
A0A3B4CGU9_MCL1-03      ----GGSALVEETRRLIGGFYRGYIG--QKTRDQHPAHGTMSRVVEGVIL
A0A3B4CGU9_MCL1-02      PKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVVEGMLH
                                *  :*  :: .* ..:         :. .  *: ***:*:: 

A0A3B4C6H5_MCL1-01      KHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFG
A0A3B4C6H5_MCL1-03      KHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFG
A0A3B4CGU9_MCL1-03      KHSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLVAFG
A0A3B4CGU9_MCL1-02      KHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFDDGITNWGRIASLVALG
                        **.:.*.**. ** :*:..*.* :* :*** **.** *********:*:*

A0A3B4C6H5_MCL1-01      AVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHV
A0A3B4C6H5_MCL1-03      AVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHV
A0A3B4CGU9_MCL1-03      AVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFVEFFRE
A0A3B4CGU9_MCL1-02      AVVCEWLKEVGREQCVENVIQHISMYLSTDQRQWLINNKAWGGFVEFFRE
                        ****:. :: ** :**. * * ** ** :**.:**::****.******. 

A0A3B4C6H5_MCL1-01      PDPESKMRNALMALVTAAGVGAGLVLLSR
A0A3B4C6H5_MCL1-03      PDPESKMRNALMALVTAAGVGAGLVLLSR
A0A3B4CGU9_MCL1-03      DDSESRVRNALMAFAGFAGLGAGLALLMR
A0A3B4CGU9_MCL1-02      DDSESRVRNALMAFAGFAGLGAGLALLMR
                         *.**.:******:.  **:****.** *

© 1998-2020Legal notice