Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------mfgrtrnlvig---yc----g-----g-glg-assga------l-----------------
maaaaaaaaaagaagmtgs---lk-ra-pdlnl-klrqp-yvwsq-a---a-----tppggr-laaesepgdlllepepe
  tp s pdtralvagrdrgpy--kh-wa-ylssatsvkq scgarpdgepgplelgdaangpestslaata        
             mmhgvgysqdrheyl-nfvq - aer  e   feaapgswgpppgytptemqepkqinr        
               dfpctrpyne-i vk ii v          ai e wnrtae e  es hifmrkdak        
               aa asklsq g  q  gh                 e gp      dp ge ga   g        
                   fge   d  m   g                 d ad                 e        
                   ea    a  c   e                    a                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pepfetrprrtfsplapqphvtsgsrrevgggeeptlvggspgdgppasltpearrvarpapigaevpdvtatperllff
  ee epf prapdg aglgpgp apqsqeeevdggvie d nasaivaffvfgaalcaesvnkeme l gqvq wmvay
                         agqrftq sde fq g  w rl                                 
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aptrralpseemedpeleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdyg
le  l dwihssgawaad  msped ld                 gye e lgkr avlpll          l  easn 
             g                                                                  
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvslcfplyilnpsvipkrt
sstd                      gsl stpppa ee d ly q  eiisryl eqatg          ysqwhlpds
                                                                         ppaaa d
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------p--r--a------stlrragdgfq-rrherafrgmlr-l------a--s-f--v----f-dgv--wgr
nrpgisttdrgf-ra-yg-rttkynesrs-vysevns-prrtvyqdrasq-hitpgd-vq-i-sr-mvev-s---nn---
ppartapakdaklmgasrsasrnal-amkqfa---e tnygktwsalvqkvdvknetdykr leqmvehllrgspt    
 a ng  ppsssagp pvpvpsvvhq---n--tsp- n---srlkpytpnmntysisrryt  tt snke q  lv    
       gha a d  esipmpatsrvqqft lris lkvn n aewsgl alhlfn qrl  n  ada  e  is    
                   g a  klm  ei fk r kela f   p d    a    ag   a       c        
                         a   a   d     f  d   c c                               
                                                a                               

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
iv--fsfgg-lckesv--e-------------------------laewm---l------wi--nggW-dgfvelfg----
--tl----af----l-sk-iwwqesciepqvkqgdpemqvlvsri---itdy-vrtlrd--qkqts-eyspy--y-vedl
v afiv c-avavh-krinaalkvwtyqglpge    vsrdrqn-vts-atvindhkep lvear-  -t--nf-hpnaa
l mvvt avvpsrrprnvt   hqkgmke         ap  d vsyllver ttrhht  rss-   h-itkkirnsmp
     e   tmlekgpdrr   dkd la                fqrfccai enqage  hq-    fe sd  elpl 
     a   l iag lteq       a                  clc   f agn aa   d     aa ca  akg  
         i      p                             a               a             d   
                                                                                

       490       500       510         
....:....|....:....|....:....|....:....
                                       
-----------------l----g----g--l--------
eesrkgrerfngsirnv-lafa-vtgv-av-lyllrsrk
a a rlqplnwagwltlrwfltlmavlavgvagsifrll
l       g dfvv sawttvleslfavttttsfyykh 
               r kvqavalgakicimifawtg  
               p   l s ac g  dg   as   
                   g               l   
                                       
© 1998-2022Legal notice