Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------pdtrrlvadylgyklrq-g-----gpglgpastsl---------------
mfglkrnaviglnlycggaglgmmmtpatf----e--i-fv--c---k-yvwga--de--sglpappaltpearrvarpa
                      agasgrsagynhaiw-nl-st-tsep gscsqta-apw-adgptgs            
                       asgdcmsyske-alvk-nqsvravv  gedgrvi-esp-ae- ep            
                        ha  frqrg n aqgkil a   r  e   qi s enw--r a             
                            epel  l  me gi            f  g dgrsa                
                             g g  d     eh            a    a k                  
                                         e                                      
                                         a                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------alrragdefqrr-
pigaevpdvtatperllffaptrritpsqpnrnpswhaprsprarttgypsaslgprpvvvprvvhqtmka-a-sve--y
                   tespmels eimga ppdlimggplnlstpkpsppmkassppsplelv----v-t---tnh
                      egaf  aege  aaa add edlgdpghdekadg egilmlkaklvqqst srtsnkf
                                          a eaa aea a  a  aaa aa  emeaqn lkprlev
                                                                  ag  ni fgidk l
                                                                      f   d     
                                                                      e         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         :    :       .. .  .   .                               
rrafsdmlsqlhvtpgtayqs-feqvveelfrdgvn-WGRiVaffsFggalcvesvnke---me-lvep-----------
-ktlqglvpk-dikneddvrriltrmmvhvlsgsptngaklatlivrsafvskklldiniww--v-lsrqvkqgdpevar
etswrayaa-v--ysisrqkt sstisnry qeqlv    v mvvt c vmlahgktv-aalqqscirqlpge       
nsr psttrpmnthlfnlryq  ne idke e  is    d kpmg a tairrapstt   kvptyqn           
agn kppsqnaeledde agl  l  asa  c  a          e   i ae   rrq   dswgmke           
  f aecpgl aea         a                     a          pe     kd  g            
  d     d                                               e          d            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :   :          *:                                                           
----iaewmtaylnthlrdWiq-nggwd-gfvelygveale-------------r--rw---------------------
drqrvqtsiatviertkep l-s-----l----ffhpnm--esrklrerfnasw-smnvspppgnagpvimsieekmead
    lvylvverhvdrhat vhesr  ehtatk-rvn-daagaergqqlqwgvilrltt                     
     slglqdn tnqfqg  vqq   a e idkcrrs-pr p  rkpkndfgvkqcpm                     
     gdf cri agnahe  rk      a caa ekppel     h gcae fc  kl                     
      a    f   a ga   d             dllc             e   ca                     
                      a              g                                          
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------lltfagvagvvtlgaylsrk-------------------------------------------
arsiyvgnvdygataeefvagmtsgaliagvtlfi--lsghpkgfayiefsdkesvrtslaldeslfrgrqikvslcfpl
                 wtswlllcnkglvls---ysfl                                         
                 srqvfhitfsant--s wtr                                           
                  eglvegs c crmli ls                                            
                    h a      d if gh                                            
                    a             cd                                            
                                  a                                             
                                                                                

       410       420       430       440       450       460         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
---------------------------------------------------------------------
yilysqvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
© 1998-2020Legal notice