Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------mfgrtrnlvig---ycg---g--
mahagrtsysnrelvvkylsyklsqrgyswsqfidagemaaaapaaaaagaagmtgsg--lk-ha-pdlnl-a-gep-ga
      mgqd   i mdfih   a k  e       ednrtppagptttpmvtgsdr-rn--wr-wa-ylas-lragleg
                                      ag e se dpselimsrvpyppprpayp-spvqrvttvasyv
                                               eragefpgqisklysk- lrnfpintspqkass
                                                    adfpgngedqhg aq  gg ka ph a 
                                                     a acfa  ped  d  ae g  g    
                                                        ae        c             
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---gagpppgslea------------------------------alreagd--------------r-rr-fs-----l--
assrptlggarvlltppggrllatgakdakpmgrsgaasrkalqtekrptalllepepepeefer-y--a--dmlsq-hv
gppae-dyasg-hs                            heemla-a-          svqtphektwqplapkvdi
lgg--v---natgq                             a----v-t          rpsnnfntrlrgyvanpnt
cdaq ssvw--s--                              vqqqt l          pirlkvasnapaptrlmgp
     diampwdsr                              m  ni f          ke kep pf kegsqg al
      e  dv p                                  f  e          g  e l  d a c g    
          p k                                                d             d    
          k                                                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 . ..    .                                                      
tpg-avqs-feqvveelfrdgpn-wgrivalfsfggalcvesvnke---m-plvep---------------iaewmtayl
---trrkriltremvtvvegsvgndspp-tf---aa-vak-lp---iww-v-----qvkqgdpevardrqrl---la-f-
kseddyev gsgmspheis dlt a ala--tve--r---p--iinaalqevditrlpge           -qtsi-t-a
ynis-q-q ege eng lq  iv    v svip crfmsrhakdga   eqscysa               vpyr-vfvi
hlfnp-yt  nt dgk  g   s      m vt   v largltvt   kswtmqq               tvll ler 
g  a gsl  a  ada  c             e   t iek  srq   dkdglkn                saf cdi 
a    ar                         a   i      re         ge                        
      g                                    p          d                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ntrladwiqenggwd--------------------------------------------------------fvglygnga
-rh-r--l---edpeleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiy-enfdyns
v--r-pp-hss-a-aag  msped ld                 gye e lgkr avlpll          lt-fvsved
pdtkel seqqr- -td                                                      -ckeahp--
enqhht  vkm    h                                                         dk rksm
tgnage  rd                                                               a  edpl
a    a   a                                                                      
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tae--------------v--------glp-g-ay-ers--e---------------------------------------
le-eleahfhgcgsvrr-lllfdkvs---k-f--lsf-dk-svrtslaldesllrgrqvkvslcfplyilysqvipkrtn
--darrlregnwavinnltiaclgfgshgttpppiiekgqplfnq weiiswyfteqtig                    
st           gw tawvtvalsafvvsvltsf--eld rydf  lslrrf slmata                    
al              p  tqaveltakiadvlfawyr r          kt    al                      
p                   g  a c  ac mi  lt  l                                        
                               g   as                                           
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------g-----------------------------------
rpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyr-rvrkldikneddvkslsrvmvhvfsdgvtnwgriv
      akdak mg sg asrkaletlr vgd vq  nhetafqaval                                
                                             wlt                                
                                             mic                                
                                             c                                  
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------s----------------------------------
tlisfgvlvcrhprsirqqscieplcrsitdvlvrtkrdwlvklt-wyspynkihvedleggirnvllafagvagvgagl
      afpakglkr nhek aagfaecc              agglfgrkeffal                        
                                           srayl iv                             
                                           q   d hs                             
                                                 f                              
                                                                                
                                                                                
                                                                                

     
....:
     
-----
aylir
     
     
     
     
     
     
     
© 1998-2021Legal notice