Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------mfgrtrnlvig---ycgg--g----
mahagrtsysnrelvvkylsyklsqrgyswsqfidamaaaaaapaaagaagmtps-p-lk-ra-adlnl-a--ep-pgas
      mgqd   i mdfih   a k  e       getrtspagttptvmgrgrg-p--ph-wp-ylps-lraglgasp
                                    ednp e  e respaifdgyrnyrk-yl-prvqpvttvaqevgg
                                       g    d  ale egvcsklgnhswhqnfsiakr stpysca
                                                   d saqiedqeppaladgg  n qk h   
                                                   a   fa    g  c  de           
                                                       e     d                  
                                                       a     a                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-gagp--pg-gl-----------------------------qalreagd--------------r-rr-fs-----l--tp
s-ptlgpa-n--tppggrllatgakdakpmgrsgaasrkalatekrptalllepepepeefer-y--a--dmlsq-hv--
ps---vw-slrv                            h-emla-a-          svqtphektwqplapkvdiks
grkresiyagpa                            es----v-t          rpsnnfntrlrgyvanpntyn
adeddpavwdv                             srvqqqt l          pirlkvasnapaptrlmgphl
la a   spse                             klm  ni f          ke kep pf kegsqg alg 
       gmpa                              e   f  e          g  e l  d a c g    a 
         a                                                 d             d      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               . ..    .                                                        
-g-arqsfeqvveelfrdgpn-wgrivalfsfggalcvesvnke-------mep-v-------------iaewmtaylnt
i-trvkrltremvtvvegsvgndspp-tf---aa-vak-lp---iwwqesc-q-l-trgdpevardrqrl---la-f--r
 esdyevgsgmspheis dlt a ala--tve--r---p--iinaalkvwti-vdpsq           -qtsi-t-av-
 fd-q-qege eng lq  iv    v svip crfmsrhakdga   dkdgeveq ga           vpyr-vfvipd
 dap-yl nt dgk  g   s      m vt   v largltvt       ys   kn           tvll ler en
  n gti a  ada  c             e   t iek  srq       lk   de            saf cdi tg
     s                        a   i      re                                   a 
     g                                   p                                      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rladwiqenggwdl-------------------------------------------------------fvglygngata
h-r--l---edpeaeaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiy-enfdynsle
-r-pp-hss-a-atd  msped ld                 gye e lgkr avlpll          lt-fvsved--
tkel seqqr- -gg                                                      -ckeahp--st
qhht  vkm    -                                                         dk rksmal
nage  rd     h                                                         a  edplp 
   a   a     e                                                                  
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e------------rrv-------sglpkgfayler---------------------------------------------
-eleahfhgcgsv---lllfdkvg-v--t---i-fsdkesvrtslaldeslfrgrqikvslcfplyilysqvipkrtnrp
dsrrlregnwavinnwtitclgfashvt-pppfi-kld ly q  eiisryl eqatg                      
 a kgq    erw tlwvavats-f-gsvlts-wee l                                          
           gf paftqgvlltakialgslasyr                                            
                  game c  aldvlf lt                                             
                     a     c mi  as                                             
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gisttdrgfpraryrarttnynssrsrvysgvnsrprgrvyrgrarkldikneddvkslsrvmvhvfsdgvtnwgrivtl
    akdakemgnsgwasrkalltlrtfgdvfq  nhetafq wvc                                  
    srk r lfdfs l lrwfe gml agcit          ml                                   
        q           t    a   a  l                                               
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
isfgvlvcrhprsirqqscieplcrsitdvlvrtkrdwlvkatswyspynkihvedleggirnvllafagvagvgaglay
    afpakglkr nhek aagfaecc              lrgyfgrkeffal                          
                                         sgall iv                               
                                         q   d hs                               
                                               f                                
                                                                                
                                                                                
                                                                                

   
...
   
---
lir
   
   
   
   
   
   
   
© 1998-2020Legal notice