Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------mfgrtrnlvig---ycgg--g----
mahagrtsysnrelvvkylsyklsqrgyswsqfidamaaaaaapaaagaagmtps-p-lk-ra-adlnl-a--ep-gaas
      mgqd   i mdfih   a k  e       getrtspagttptvmgrgrg-p--ph-wp-ylps-lragleggp
                                    ednp e  e respaifdgyrnyrk-yl-prvqpvttvapyvsg
                                       g    d  ale egvcsklgnhswhqnfsiakr st psca
                                                   d saqiedqeppaladgg  n qk h   
                                                   a   fa    g  c  de           
                                                       e     d                  
                                                       a     a                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-gagp--pgngl------------------------------alreagd--------------r-rr-fs-----l--tp
s-ptlgpaslrvtppggrllatgakdakpmgrsgaasrkalqtekrptalllepepepeefer-y--a--dmlsq-hv--
gr--evwyagpa                            haemla-a-          svqtphektwqplapkvdiks
aqerdsis-d--                            es----v-t          rpsnnfntrlrgyvanpntyn
pd d-pa-w-vr                            klvqqqt l          pirlkvasnapaptrlmgphl
la as  vpts                              em  ni f          ke kep pf kegsqg alg 
       gmse                                  f  e          g  e l  d a c g    a 
        kpa                                                d             d      
         a                                                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               . ..    .                                                        
g-avqs-feqvveelfrdgpn-wgrivalfsfggalcvesvnke-------mep-v-------------iaewmtaylnt
-trrkriltremvtvvegsvgndspp-tf---aa-vak-lp---iwwqesc-q-l-trgdpevardrqrl---la-f--r
eddyev gsgmspheis dlt a ala--tve--r---p--iinaalkvwti-vdpsq           -qtsi-t-av-
is-q-q ege eng lq  iv    v svip crfmsrhakdga   dkdgeveq ga           vpyr-vfvipd
fnp-yt  nt dgk  g   s      m vt   v largltvt       ys   kn           tvll ler en
 a gsl  a  ada  c             e   t iek  srq       lk   de            saf cdi tg
   ar                         a   i      re                                   a 
    g                                    p                                      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rladwiqenggwd-e------------------------------------------------------fvglygngata
h-r--l---edpel-aikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiy-enfdynsle
-r-pp-hss-a-aag  msped ld                 gye e lgkr avlpll          lt-fvsved--
tkel seqqr- -td                                                      -ckeah---st
qhht  vkm    ht                                                        dk -psmal
nage  rd                                                               a  rkplp 
   a   a                                                                   d    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e---------gs--rvl------gglpkglayler---------------------------------------------
-eleahfhgc--vr---llcdkvs-v--tf--i-fsdkesvrtslaldeslfrgrqikvslcfplyilysqvipkrtnrp
dsrrlregnwevinnwtiafagfashvt--spfi-kld ly q  eiisryl eqatg                      
 a kgq    arwptlfttvvvt-k-gsvppl-yse l                                          
           pr a  vqlmtscficamgtfawer                                            
           gf     gglll a allvi  st                                             
                  faea     d     a                                              
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gisttdrgfpraryrarttnynssrsrvysgvnsrprgrvyrgrarkldikneddvkslsrvmvhvfsdgvtnwgrivtl
    akdakemgnsgwasrkalltlrtfgdvfq  nhetafq wvc                                  
    srk r lfdfs l lrwfe gml agcit          ml                                   
        q           t    a   a  l                                               
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
isfgvlvcrhprsirqqscieplcrsitdvlvrtkrdwlvkatswyspynkihvedleggirnvllafagvagvgaglay
    afpakglkr nhek aagfaecc              lrgyfgrkeffal                          
                                         sgall iv                               
                                         q   d hs                               
                                               f                                
                                                                                
                                                                                
                                                                                

   
...
   
---
lir
   
   
   
   
   
   
   
© 1998-2021Legal notice