Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6GWM6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K6EKG1_BCL2A1-      ------------------------MTDCEFGYTHRLVQDYLQYVLRVP--
A0A2K6GWM6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K6F2Q2_BCL2L10      ------------------------MGDRFRERTERLLADYLEYCTREPG-
A0A2K6F6N9_MCL1-01      ----------------------------------DLWINLGISC----G-
A0A2K6GI15_MCL1-03      ----------------------------MFGLKRNAVIGLNLYC----G-
A0A2K6GI15_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K6G3I7_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLAQRGY
                                                                          

A0A2K6GWM6_BCL2L2-      VCGAGPGEGPAADPL-----------------------------------
A0A2K6EKG1_BCL2A1-      ----QPGSGPSKTSR-----------------------------------
A0A2K6GWM6_BCL2L2-      VCGAGPGEGPAADPL-----------------------------------
A0A2K6F2Q2_BCL2L10      ----APGLPPSSLEA-----------------------------------
A0A2K6F6N9_MCL1-01      ----RADLGWAWLGL-----------------------------------
A0A2K6GI15_MCL1-03      ----GAGLGAGSSGATPP--------------------------------
A0A2K6GI15_MCL1-01      GEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFA
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      SWSQFIDAEENRTEAPEA-------------------------------T
A0A2K6G3I7_BCL2-01      EW----DAGDAGAAPPGA-------------------------------A
                                                                          

A0A2K6GWM6_BCL2L2-      ---------------------------------------------HQAMR
A0A2K6EKG1_BCL2A1-      -----------------------------------------------VLQ
A0A2K6GWM6_BCL2L2-      ---------------------------------------------HQAMR
A0A2K6F2Q2_BCL2L10      ----------------------------------------------AAMR
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------GGRLLATGAKDAKPMGRSGAASRKALETLR
A0A2K6GI15_MCL1-01      PTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
A0A2K6G3C5_BCL2L1-      -----------------------------------------------MQK
A0A2K6G3C5_BCL2L1-      ESEMETPSAINGNPSWHLADSPPANGATGHSSSLDAREVIPMAAVKQALK
A0A2K6G3I7_BCL2-01      PTPGIFSSQPGRNPPPAAPRDPAARTSPPPAAAAGPAPSPVPPVVHLTLR
                                                                          

A0A2K6GWM6_BCL2L2-      AAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGR
A0A2K6EKG1_BCL2A1-      NIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFEDGIVNWGR
A0A2K6GWM6_BCL2L2-      AAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGR
A0A2K6F2Q2_BCL2L10      FAATKIRRKHASFFSAYVG----YPGNRVYL-LERMAEAVLCDSLS-WGR
A0A2K6F6N9_MCL1-01      -----------KAFQGMLQKLDIKNEDDVKS-LSRVMVHVFSDSVTNWGR
A0A2K6GI15_MCL1-03      RVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGR
A0A2K6GI15_MCL1-01      SNGSSTD----GSLPSTPPPAEEEDDELYRQ-SLEIISRYLREQAT-GAK
A0A2K6G3C5_BCL2L1-      RTGLRPQKRLNRRWRPPVPLMATHPGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3C5_BCL2L1-      EAGDEFELRYRRAFSDLTSQLHITLGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3I7_BCL2-01      QAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVVEELFRDGVN-WGR
                                                           :    :       ..

A0A2K6GWM6_BCL2L2-      LVAFFVFGAALCAESVNKE---MEPLVGQ---------------VQEWMV
A0A2K6EKG1_BCL2A1-      IVTVFAFGGILIKKLLREQIALDVDTYKE---------------ISYFIA
A0A2K6GWM6_BCL2L2-      LVAFFVFGAALCAESVNKE-------MEPLVGQ-----------VQEWMV
A0A2K6F2Q2_BCL2L10      VVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLC
A0A2K6F6N9_MCL1-01      IVTLISFCAFVSKHLKTIN---QESCIEP---------------LAESIT
A0A2K6GI15_MCL1-03      IVTLISFGAFVAKHLKSIN---QESCIEP---------------LAESIT
A0A2K6GI15_MCL1-01      DAKPMGRSGAASRKALET--------LRR---------------VGDGVQ
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE---MQVLVSR---------------IATWMA
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE---MQVLVSR---------------IATWMA
A0A2K6G3I7_BCL2-01      IVAFFEFGGVMCVESVNRE---MSPLVDN---------------IALWMT
                         .  .   .                                   :   : 

A0A2K6GWM6_BCL2L2-      AYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
A0A2K6EKG1_BCL2A1-      EFITNNAGEWIRQNGGWEHGFVKKFEP-----------------R--PA-
A0A2K6GWM6_BCL2L2-      AYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLREGNWASVR--TV-
A0A2K6F2Q2_BCL2L10      ARLAGQHRAWLQAQGGWD-GFCDLFRKPLPL----------AVWR--RL-
A0A2K6F6N9_MCL1-01      DILVRTKRDWL------------FFHVEDLE----------GSIR--NV-
A0A2K6GI15_MCL1-03      DVLVRTKRDWLVKQRGWD-GFVEFFHVEDLE----------GGIR--NV-
A0A2K6GI15_MCL1-01      RNHETAFQGWV-------------CGVLPCRGPRRRHQKCAAGFCRCCW-
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFN------RW-
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFN------RW-
A0A2K6G3I7_BCL2-01      EYLNRHLHTWIQDNGGWD-AFVELYGPSM-------RPLFDFSWLSLKT-
                                 *:                                       

A0A2K6GWM6_BCL2L2-      PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNR
A0A2K6EKG1_BCL2A1-      -------------------------------------WLTFLEVTGKICD
A0A2K6GWM6_BCL2L2-      -------------------------------------LTGAVALGALVTV
A0A2K6F2Q2_BCL2L10      -------------------------------------LVQVLLSCFLATT
A0A2K6F6N9_MCL1-01      -------------------------------------LLAFAGVAGVGAG
A0A2K6GI15_MCL1-03      -------------------------------------LLAFAGVAGVGAG
A0A2K6GI15_MCL1-01      -------------------------------------SRSWFGISNKIAL
A0A2K6G3C5_BCL2L1-      -------------------------------------FLTGMTVAGVVLL
A0A2K6G3C5_BCL2L1-      -------------------------------------FLTGMTVAGVVLL
A0A2K6G3I7_BCL2-01      -------------------------------------LLSLALVGACITL
                                                                          

A0A2K6GWM6_BCL2L2-      VTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVSLCFPL
A0A2K6EKG1_BCL2A1-      MLSLLYS-------------------------------------------
A0A2K6GWM6_BCL2L2-      GAFFASK-------------------------------------------
A0A2K6F2Q2_BCL2L10      VIYFWTRLL-----------------------------------------
A0A2K6F6N9_MCL1-01      LTYLIR--------------------------------------------
A0A2K6GI15_MCL1-03      LAYLIR--------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      GSLFSRK-------------------------------------------
A0A2K6G3C5_BCL2L1-      GSLFSRK-------------------------------------------
A0A2K6G3I7_BCL2-01      GAYLGHK-------------------------------------------
                                                                          

A0A2K6GWM6_BCL2L2-      YILYSQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
                                                                          

A0A2K6GWM6_BCL2L2-      PRGRVYRGRARATSWYSPY
A0A2K6EKG1_BCL2A1-      -------------------
A0A2K6GWM6_BCL2L2-      -------------------
A0A2K6F2Q2_BCL2L10      -------------------
A0A2K6F6N9_MCL1-01      -------------------
A0A2K6GI15_MCL1-03      -------------------
A0A2K6GI15_MCL1-01      -------------------
A0A2K6G3C5_BCL2L1-      -------------------
A0A2K6G3C5_BCL2L1-      -------------------
A0A2K6G3I7_BCL2-01      -------------------
                                           

© 1998-2020Legal notice