Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EKG1_BCL2A1-      ---------------MTDCEFGYTHRLVQDYLQYVLRVPQ----------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      -------------------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAE
A0A2K6G3I7_BCL2-01      -------------MAHAGRTGYDNREIVMKYIHYKLAQRGYEW----DAG
A0A2K6GI15_MCL1-01      -------------------MFGLKRNAVIGLNLYC----G-----GAGLG
A0A2K6GI15_MCL1-02      -------------------MFGLKRNAVIGLNLYC----G-----GAGLG
A0A2K6GWM6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCG----A----G----------
A0A2K6GWM6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPG----A----G-----GEAGE
A0A2K6GWM6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPG----A----G-----GEAGE
A0A2K6GWM6_BCL2L2-      --------------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEG
A0A2K6F2Q2_BCL2L10      ---------------MGDRFRERTERLLADYLEYCTREPG-----APGLP
A0A2K6F6N9_MCL1-01      -------------------------DLWINLGISC----G-----RADLG
A0A2K6GI15_MCL1-03      -------------------MFGLKRNAVIGLNLYC----G-----GAGLG
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ENRTEAPEATESEMETPSAING----------------------------
A0A2K6G3I7_BCL2-01      DAGAAPPGAAPTPGIFSSQPGR----------------------------
A0A2K6GI15_MCL1-01      AGSSGATPPGGRLLAAEKEATA----------------------------
A0A2K6GI15_MCL1-02      AGSSGATPPGGRLLAAEKEATA----------------------------
A0A2K6GWM6_BCL2L2-      ---PGEGPAADPLHQAMRAAGD----------EFETRFRRTFSDLAAQLH
A0A2K6GWM6_BCL2L2-      GAPGGAGDYGNGLESEELEPGD----------------------------
A0A2K6GWM6_BCL2L2-      GAPGGAGDYGNGLESEELEPGELLLEPEPEPEPEEEPPRPRAPPGAPGPG
A0A2K6GWM6_BCL2L2-      PAADPL--------------------------------------------
A0A2K6F2Q2_BCL2L10      PSSLEA--------------------------------------------
A0A2K6F6N9_MCL1-01      WAWLGL--------------------------------------------
A0A2K6GI15_MCL1-03      AGSSGATPPGGRLLATGAKDAK----------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GI15_MCL1-01      -----RREVGGGEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDV
A0A2K6GI15_MCL1-02      -----RREVGGGEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDV
A0A2K6GWM6_BCL2L2-      VTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLV
A0A2K6GWM6_BCL2L2-      --------QEEEEEPGLVEGDPGDGAI-----------------------
A0A2K6GWM6_BCL2L2-      PGSGAPGSQEEEEEPGLVEGDPGDGAI-----------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GI15_MCL1-01      TATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELD------------
A0A2K6GI15_MCL1-02      TATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELD------------
A0A2K6GWM6_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNE
A0A2K6GWM6_BCL2L2-      ----------------------EDPELEAIKARVREMEEEAEKLKELQNE
A0A2K6GWM6_BCL2L2-      ----------------------EDPELEAIKARVREMEEEAEKLKELQNE
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GI15_MCL1-01      -----GYEPEPLGKRPAVLPLLE---------LVGEASNGSSTD------
A0A2K6GI15_MCL1-02      -----GYEPEPLGKRPAVLPLLE---------LVGEASNGSSTD------
A0A2K6GWM6_BCL2L2-      VEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHF
A0A2K6GWM6_BCL2L2-      VEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHF
A0A2K6GWM6_BCL2L2-      VEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHF
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GI15_MCL1-01      ----------------GSLPSTPPPAEEEDDELYRQSLEIISRYLREQAT
A0A2K6GI15_MCL1-02      ----------------GSLPSTPPPAEEEDDELYRQSLEIISRYLREQAT
A0A2K6GWM6_BCL2L2-      HGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQI
A0A2K6GWM6_BCL2L2-      HGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQI
A0A2K6GWM6_BCL2L2-      HGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQI
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      ------------------------------------PGSGPSKTSRVLQN
A0A2K6G3C5_BCL2L1-      ----------------------------------------------MQKR
A0A2K6G3C5_BCL2L1-      -----------NPSWHLADSPPANGATGHSSSLDAREVIPMAAVKQALKE
A0A2K6G3I7_BCL2-01      -----------NPPPAAPRDPAARTSPPPAAAAGPAPSPVPPVVHLTLRQ
A0A2K6GI15_MCL1-01      G--------------------------AKDAKPMGRSGAASRKALETLRR
A0A2K6GI15_MCL1-02      G--------------------------AKDAKPMGRSGAASRKALETLRR
A0A2K6GWM6_BCL2L2-      KVSLCFPLYILYSQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A2K6GWM6_BCL2L2-      K-------------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A2K6GWM6_BCL2L2-      K-------------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A2K6GWM6_BCL2L2-      --------------------------------------------HQAMRA
A0A2K6F2Q2_BCL2L10      ---------------------------------------------AAMRF
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------PMGRSGAASRKALETLRR
                                                                          

A0A2K6EKG1_BCL2A1-      IAFSVQ-NEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFEDGIVNWGR
A0A2K6G3C5_BCL2L1-      TGLRPQ-KRLNRRWRPPVPLMATHPGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3C5_BCL2L1-      AGDEFE-LRYRRAFSDLTSQLHITLGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3I7_BCL2-01      AGDDFS-RRYRRDFAEMSSQLHLTPFTARGR-FATVVEELFRDGVN-WGR
A0A2K6GI15_MCL1-01      VGDGVQ-RNHETAFQGWVC-------------------------------
A0A2K6GI15_MCL1-02      VGDGVQ-RNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGR
A0A2K6GWM6_BCL2L2-      FYSGFNSRPRGRVYRGRAR-------------------------------
A0A2K6GWM6_BCL2L2-      FYSGFNSRPRGRVYRGRAR-------------------------------
A0A2K6GWM6_BCL2L2-      FYSGFNSRPRGRVYRGRAR-------------------------------
A0A2K6GWM6_BCL2L2-      AGDEFE-TRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGR
A0A2K6F2Q2_BCL2L10      AATKIR-RKHASFFSAYVG----YPGNRVYL-LERMAEAVLCDSLS-WGR
A0A2K6F6N9_MCL1-01      -----------KAFQGMLQKLDIKNEDDVKS-LSRVMVHVFSDSVTNWGR
A0A2K6GI15_MCL1-03      VGDGVQ-RNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGR
                                                                          

A0A2K6EKG1_BCL2A1-      IVTVFAFGGILIKKLLREQIALDVDTYKE---------------ISYFIA
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE------------------MQVLVSRIATWMA
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE------------------MQVLVSRIATWMA
A0A2K6G3I7_BCL2-01      IVAFFEFGGVMCVESVNRE------------------MSPLVDNIALWMT
A0A2K6GI15_MCL1-01      -------GVLPCRGPRR-R---HQKCAAG---------------FCRCC-
A0A2K6GI15_MCL1-02      IVTLISFGAFVAKHLKSIN---QESCIEP---------------LAESIT
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      LVAFFVFGAALCAESVNKE-------MEPLVGQ-----------VQEWMV
A0A2K6F2Q2_BCL2L10      VVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLC
A0A2K6F6N9_MCL1-01      IVTLISFCAFVSKHLKTIN---QESCIEP---------------LAESIT
A0A2K6GI15_MCL1-03      IVTLISFGAFVAKHLKSIN---QESCIEP---------------LAESIT
                                                                          

A0A2K6EKG1_BCL2A1-      EFITNNAGEWIRQNGGWEHGFVKKFEP-----------------RPAWLT
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGW-DTFVELYGNNAAAESRKGQERFN------RWF
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGW-DTFVELYGNNAAAESRKGQERFN------RWF
A0A2K6G3I7_BCL2-01      EYLNRHLHTWIQDNGGW-DAFVELYGPSM-------RPLFDFSWLSLKTL
A0A2K6GI15_MCL1-01      ---------W---SRSW-FGISNKIAL-----------------------
A0A2K6GI15_MCL1-02      DVLVRTKRDWLVKQRGW-DGFVEFFHVEDLE----------GGIRNVLLA
A0A2K6GWM6_BCL2L2-      -------------ATSW-YSPY----------------------------
A0A2K6GWM6_BCL2L2-      -------------ATSW-YSPY----------------------------
A0A2K6GWM6_BCL2L2-      -------------ATSW-YSPY----------------------------
A0A2K6GWM6_BCL2L2-      AYLETRLADWIHSSGGW-AEFTALYGDGALEEARRLREGNWASVRTVLTG
A0A2K6F2Q2_BCL2L10      ARLAGQHRAWLQAQGGW-DGFCDLFRKPLPL----------AVWRRLLVQ
A0A2K6F6N9_MCL1-01      DILVRTKRDWL------------FFHVEDLE----------GSIRNVLLA
A0A2K6GI15_MCL1-03      DVLVRTKRDWLVKQRGW-DGFVEFFHVEDLE----------GGIRNVLLA
                                                                          

A0A2K6EKG1_BCL2A1-      FLEVTGKICDMLSLLYS--
A0A2K6G3C5_BCL2L1-      LTGMTVAGVVLLGSLFSRK
A0A2K6G3C5_BCL2L1-      LTGMTVAGVVLLGSLFSRK
A0A2K6G3I7_BCL2-01      LSLALVGACITLGAYLGHK
A0A2K6GI15_MCL1-01      -------------------
A0A2K6GI15_MCL1-02      FAGVAGVGAGLAYLIR---
A0A2K6GWM6_BCL2L2-      -------------------
A0A2K6GWM6_BCL2L2-      -------------------
A0A2K6GWM6_BCL2L2-      -------------------
A0A2K6GWM6_BCL2L2-      AVALGALVTVGAFFASK--
A0A2K6F2Q2_BCL2L10      VLLSCFLATTVIYFWTRLL
A0A2K6F6N9_MCL1-01      FAGVAGVGAGLTYLIR---
A0A2K6GI15_MCL1-03      FAGVAGVGAGLAYLIR---
                                           

© 1998-2022Legal notice