Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEATESE
A0A2K6G3I7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLAQRGYEW----DAGDAGAAPPGAAPTP
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-02      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------MATPASAPDTRA
A0A2K6GWM6_BCL2L2-      --------------------------------------MAAAAAAAAAAG
A0A2K6GWM6_BCL2L2-      --------------------------------------MAAAAAAAAAAG
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      METPSAINGNPSWHLADSPPANGATGHSSSLDAREVIPMAAVKQ------
A0A2K6G3I7_BCL2-01      GIFSSQPGRNPPPAAPRDPAARTSPPPAAAAGPAPSPVPPVVHL------
A0A2K6GI15_MCL1-01      -------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLA------
A0A2K6GI15_MCL1-02      -------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLA------
A0A2K6GWM6_BCL2L2-      LVADFVGYKLRQKGYVCG----AG--------PGEGPAADPLHQ------
A0A2K6GWM6_BCL2L2-      AAGGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGDYGNGLES------
A0A2K6GWM6_BCL2L2-      AAGGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGDYGNGLES------
A0A2K6EKG1_BCL2A1-      ---MTDCEFGYTHRLVQDYLQYVLRVP------QPGSGPSKTSR------
A0A2K6GWM6_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPL------
A0A2K6F2Q2_BCL2L10      ---MGDRFRERTERLLADYLEYCTREPG-----APGLPPSSLEA------
A0A2K6F6N9_MCL1-01      -------------DLWINLGISC----G-----RADLGWAWLGL------
A0A2K6GI15_MCL1-03      -------MFGLKRNAVIGLNLYC----G-----GAGLGAGSSGATPPGGR
                                                                          

A0A2K6G3C5_BCL2L1-      ------------------------MQKRTGL----------RPQKRLNRR
A0A2K6G3C5_BCL2L1-      ------------------------ALKEAGD----------EFELRYRRA
A0A2K6G3I7_BCL2-01      ------------------------TLRQAGD----------DFSRRYRRD
A0A2K6GI15_MCL1-01      ------------------------AEKEATA-------------------
A0A2K6GI15_MCL1-02      ------------------------AEKEATA-------------------
A0A2K6GWM6_BCL2L2-      ------------------------AMRAAGD----------EFETRFRRT
A0A2K6GWM6_BCL2L2-      ------------------------EELEPGD-------------------
A0A2K6GWM6_BCL2L2-      ------------------------EELEPGELLLEPEPEPEPEEEPPRPR
A0A2K6EKG1_BCL2A1-      ------------------------VLQNIAF----------SVQNEVEKN
A0A2K6GWM6_BCL2L2-      ----------------------HQAMRAAGD----------EFETRFRRT
A0A2K6F2Q2_BCL2L10      -----------------------AAMRFAAT----------KIRRKHASF
A0A2K6F6N9_MCL1-01      ------------------------------------------------KA
A0A2K6GI15_MCL1-03      LLATGAKDAKPMGRSGAASRKALETLRRVGD----------GVQRNHETA
                                                                          

A0A2K6G3C5_BCL2L1-      WRPPVPLMATHPGTAYQS-FEQVVNELFRDGVN-WGRIVAFFSFGGALCV
A0A2K6G3C5_BCL2L1-      FSDLTSQLHITLGTAYQS-FEQVVNELFRDGVN-WGRIVAFFSFGGALCV
A0A2K6G3I7_BCL2-01      FAEMSSQLHLTPFTARGR-FATVVEELFRDGVN-WGRIVAFFEFGGVMCV
A0A2K6GI15_MCL1-01      --------------RREV-GGGEDGTVIGGSPG-ASPPASLTPEARRVAR
A0A2K6GI15_MCL1-02      --------------RREV-GGGEDGTVIGGSPG-ASPPASLTPEARRVAR
A0A2K6GWM6_BCL2L2-      FSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGRLVAFFVFGAALCA
A0A2K6GWM6_BCL2L2-      -----------------Q-EEEEEPGLVEGDPG-DGAI------------
A0A2K6GWM6_BCL2L2-      APPGAPGPGPGSGAPGSQ-EEEEEPGLVEGDPG-DGAI------------
A0A2K6EKG1_BCL2A1-      LKACLDNVNVASIDAARTIFNQVMEKEFEDGIVNWGRIVTVFAFGGILIK
A0A2K6GWM6_BCL2L2-      FSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGRLVAFFVFGAALCA
A0A2K6F2Q2_BCL2L10      FSAYVG----YPGNRVYL-LERMAEAVLCDSLS-WGRVVMLVTFAGTLLE
A0A2K6F6N9_MCL1-01      FQGMLQKLDIKNEDDVKS-LSRVMVHVFSDSVTNWGRIVTLISFCAFVSK
A0A2K6GI15_MCL1-03      FQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVTLISFGAFVAK
                                                   . ..    .              

A0A2K6G3C5_BCL2L1-      ESVDKE---MQVLVSR---------------IATWMATYLNDHLEPWIQE
A0A2K6G3C5_BCL2L1-      ESVDKE---MQVLVSR---------------IATWMATYLNDHLEPWIQE
A0A2K6G3I7_BCL2-01      ESVNRE---MSPLVDN---------------IALWMTEYLNRHLHTWIQD
A0A2K6GI15_MCL1-01      PAPIGA---EVPDVTA---------------TPERLLFFAPTRRALPSEE
A0A2K6GI15_MCL1-02      PAPIGA---EVPDVTA---------------TPERLLFFAPTRRALPSEE
A0A2K6GWM6_BCL2L2-      ESVNKE---MEPLVGQ---------------VQEWMVAYLETRLADWIHS
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      KLLREQIALDVDTYKE---------------ISYFIAEFITNNAGEWIRQ
A0A2K6GWM6_BCL2L2-      ESVNKE-------MEPLVGQ-----------VQEWMVAYLETRLADWIHS
A0A2K6F2Q2_BCL2L10      RGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQA
A0A2K6F6N9_MCL1-01      HLKTIN---QESCIEP---------------LAESITDILVRTKRDWL--
A0A2K6GI15_MCL1-03      HLKSIN---QESCIEP---------------LAESITDVLVRTKRDWLVK
                                                                          

A0A2K6G3C5_BCL2L1-      NGGWDT--------------------------------------------
A0A2K6G3C5_BCL2L1-      NGGWDT--------------------------------------------
A0A2K6G3I7_BCL2-01      NGGWDA--------------------------------------------
A0A2K6GI15_MCL1-01      MEAPAADAIMSPEDELD-----------------GYEPEPLGKRPAVLPL
A0A2K6GI15_MCL1-02      MEAPAADAIMSPEDELD-----------------GYEPEPLGKRPAVLPL
A0A2K6GWM6_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A2K6GWM6_BCL2L2-      -EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A2K6GWM6_BCL2L2-      -EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A2K6EKG1_BCL2A1-      NGGWEHG-------------------------------------------
A0A2K6GWM6_BCL2L2-      SGGWA-E-------------------------------------------
A0A2K6F2Q2_BCL2L10      QGGWD-G-------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      QRGWD-G-------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      -----------FVELYGNNAAAE---------------------------
A0A2K6G3C5_BCL2L1-      -----------FVELYGNNAAAE---------------------------
A0A2K6G3I7_BCL2-01      -----------FVELYGPSM------------------------------
A0A2K6GI15_MCL1-01      LE---------LVGEASNGSSTD----------------------GSLPS
A0A2K6GI15_MCL1-02      LE---------LVGEASNGSSTD----------------------GSLPS
A0A2K6GWM6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A2K6GWM6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A2K6GWM6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A2K6EKG1_BCL2A1-      -----------FVKKFEP-----------------RPAWLTFLEVTGKIC
A0A2K6GWM6_BCL2L2-      -----------FTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVT
A0A2K6F2Q2_BCL2L10      -----------FCDLFRKPLPL----------AVWRRLLVQVLLSCFLAT
A0A2K6F6N9_MCL1-01      --------------FFHVEDLE----------GSIRNVLLAFAGVAGVGA
A0A2K6GI15_MCL1-03      -----------FVEFFHVEDLE----------GGIRNVLLAFAGVAGVGA
                                                                          

A0A2K6G3C5_BCL2L1-      -----SRKGQERFN------RWFLTGMTVA--------------------
A0A2K6G3C5_BCL2L1-      -----SRKGQERFN------RWFLTGMTVA--------------------
A0A2K6G3I7_BCL2-01      ---------RPLFDFSWLSLKTLLSLALVG--------------------
A0A2K6GI15_MCL1-01      TPPPAEEEDDELYRQSLEIISRYLREQATG--------------------
A0A2K6GI15_MCL1-02      TPPPAEEEDDELYRQSLEIISRYLREQATG--------------------
A0A2K6GWM6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTN
A0A2K6GWM6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTN
A0A2K6GWM6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTN
A0A2K6EKG1_BCL2A1-      DMLSLLYS------------------------------------------
A0A2K6GWM6_BCL2L2-      VGAFFASK------------------------------------------
A0A2K6F2Q2_BCL2L10      TVIYFWTRLL----------------------------------------
A0A2K6F6N9_MCL1-01      GLTYLIR-------------------------------------------
A0A2K6GI15_MCL1-03      GLAYLIR-------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      --------------------------------------------GVVL--
A0A2K6G3C5_BCL2L1-      --------------------------------------------GVVL--
A0A2K6G3I7_BCL2-01      --------------------------------------------ACIT--
A0A2K6GI15_MCL1-01      ------AKDAKPMGRSGAASRKALETLRRVGDGVQ-RNHETAFQGWVC--
A0A2K6GI15_MCL1-02      ------AKDAKPMGRSGAASRKALETLRRVGDGVQ-RNHETAFQGMLRKL
A0A2K6GWM6_BCL2L2-      RPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR--
A0A2K6GWM6_BCL2L2-      RPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR--
A0A2K6GWM6_BCL2L2-      RPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR--
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GI15_MCL1-01      -----------------------------------GVLPCRGPRR-RHQK
A0A2K6GI15_MCL1-02      DIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      -----------------------LGSLFSRK-------------------
A0A2K6G3C5_BCL2L1-      -----------------------LGSLFSRK-------------------
A0A2K6G3I7_BCL2-01      -----------------------LGAYLGHK-------------------
A0A2K6GI15_MCL1-01      CAAGFCRCC----------W---SRSWFGISNKIAL--------------
A0A2K6GI15_MCL1-02      CIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAF
A0A2K6GWM6_BCL2L2-      -----------------------ATSWYSPY-------------------
A0A2K6GWM6_BCL2L2-      -----------------------ATSWYSPY-------------------
A0A2K6GWM6_BCL2L2-      -----------------------ATSWYSPY-------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6G3C5_BCL2L1-      ---------------
A0A2K6G3C5_BCL2L1-      ---------------
A0A2K6G3I7_BCL2-01      ---------------
A0A2K6GI15_MCL1-01      ---------------
A0A2K6GI15_MCL1-02      AGVAGVGAGLAYLIR
A0A2K6GWM6_BCL2L2-      ---------------
A0A2K6GWM6_BCL2L2-      ---------------
A0A2K6GWM6_BCL2L2-      ---------------
A0A2K6EKG1_BCL2A1-      ---------------
A0A2K6GWM6_BCL2L2-      ---------------
A0A2K6F2Q2_BCL2L10      ---------------
A0A2K6F6N9_MCL1-01      ---------------
A0A2K6GI15_MCL1-03      ---------------
                                       

© 1998-2021Legal notice