Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EKG1_BCL2A1-      ------------------------MTDCEFGYTHRLVQDYLQYVLRVP--
A0A2K6GWM6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K6GWM6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K6F2Q2_BCL2L10      ------------------------MGDRFRERTERLLADYLEYCTREPG-
A0A2K6F6N9_MCL1-01      ----------------------------------DLWINLGISC----G-
A0A2K6GI15_MCL1-03      ----------------------------MFGLKRNAVIGLNLYC----G-
A0A2K6GI15_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K6G3I7_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLAQRGY
                                                                          

A0A2K6EKG1_BCL2A1-      ----QPGSGPSKTSR-----------------------------------
A0A2K6GWM6_BCL2L2-      VCGAGPGEGPAADPL-----------------------------------
A0A2K6GWM6_BCL2L2-      VCGAGPGEGPAADPL-----------------------------------
A0A2K6F2Q2_BCL2L10      ----APGLPPSSLEA-----------------------------------
A0A2K6F6N9_MCL1-01      ----RADLGWAWLGL-----------------------------------
A0A2K6GI15_MCL1-03      ----GAGLGAGSSGATPP--------------------------------
A0A2K6GI15_MCL1-01      GEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFA
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      SWSQFIDAEENRTEAPEA-------------------------------T
A0A2K6G3I7_BCL2-01      EW----DAGDAGAAPPGA-------------------------------A
                                                                          

A0A2K6EKG1_BCL2A1-      -----------------------------------------------VLQ
A0A2K6GWM6_BCL2L2-      ---------------------------------------------HQAMR
A0A2K6GWM6_BCL2L2-      ---------------------------------------------HQAMR
A0A2K6F2Q2_BCL2L10      ----------------------------------------------AAMR
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------GGRLLATGAKDAKPMGRSGAASRKALETLR
A0A2K6GI15_MCL1-01      PTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
A0A2K6G3C5_BCL2L1-      -----------------------------------------------MQK
A0A2K6G3C5_BCL2L1-      ESEMETPSAINGNPSWHLADSPPANGATGHSSSLDAREVIPMAAVKQALK
A0A2K6G3I7_BCL2-01      PTPGIFSSQPGRNPPPAAPRDPAARTSPPPAAAAGPAPSPVPPVVHLTLR
                                                                          

A0A2K6EKG1_BCL2A1-      NIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFEDGIVNWGR
A0A2K6GWM6_BCL2L2-      AAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGR
A0A2K6GWM6_BCL2L2-      AAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGR
A0A2K6F2Q2_BCL2L10      FAATKIRRKHASFFSAYVG----YPGNRVYL-LERMAEAVLCDSLS-WGR
A0A2K6F6N9_MCL1-01      -----------KAFQGMLQKLDIKNEDDVKS-LSRVMVHVFSDSVTNWGR
A0A2K6GI15_MCL1-03      RVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGR
A0A2K6GI15_MCL1-01      SNGSSTD----GSLPSTPPPAEEEDDELYRQ-SLEIISRYLREQAT-GAK
A0A2K6G3C5_BCL2L1-      RTGLRPQKRLNRRWRPPVPLMATHPGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3C5_BCL2L1-      EAGDEFELRYRRAFSDLTSQLHITLGTAYQS-FEQVVNELFRDGVN-WGR
A0A2K6G3I7_BCL2-01      QAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVVEELFRDGVN-WGR
                                                           :    :       ..

A0A2K6EKG1_BCL2A1-      IVTVFAFGGILIKKLLREQIALDVDTYKE---------------ISYFIA
A0A2K6GWM6_BCL2L2-      LVAFFVFGAALCAESVNKE-------MEPLVGQ-----------VQEWMV
A0A2K6GWM6_BCL2L2-      LVAFFVFGAALCAESVNKE-------MEPLVGQ-----------VQEWMV
A0A2K6F2Q2_BCL2L10      VVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLC
A0A2K6F6N9_MCL1-01      IVTLISFCAFVSKHLKTIN---QESCIEP---------------LAESIT
A0A2K6GI15_MCL1-03      IVTLISFGAFVAKHLKSIN---QESCIEP---------------LAESIT
A0A2K6GI15_MCL1-01      DAKPMGRSGAASRKALET------------LRR-----------VGDGVQ
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE-------MQVLVSR-----------IATWMA
A0A2K6G3C5_BCL2L1-      IVAFFSFGGALCVESVDKE-------MQVLVSR-----------IATWMA
A0A2K6G3I7_BCL2-01      IVAFFEFGGVMCVESVNRE-------MSPLVDN-----------IALWMT
                         .  .   .                                   :   : 

A0A2K6EKG1_BCL2A1-      EFITNNAGEWIRQNGGWEHG------------------------------
A0A2K6GWM6_BCL2L2-      AYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
A0A2K6GWM6_BCL2L2-      AYLETRLADWIHSSGGWAE-------------------------------
A0A2K6F2Q2_BCL2L10      ARLAGQHRAWLQAQGGWDG-------------------------------
A0A2K6F6N9_MCL1-01      DILVRTKRDWL---------------------------------------
A0A2K6GI15_MCL1-03      DVLVRTKRDWLVKQRGWDG-------------------------------
A0A2K6GI15_MCL1-01      RNHETAFQGWV---------------------------------------
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGWDT-------------------------------
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQENGGWDT-------------------------------
A0A2K6G3I7_BCL2-01      EYLNRHLHTWIQDNGGWDA-------------------------------
                                 *:                                       

A0A2K6EKG1_BCL2A1-      ------------------------FVKKFEP-----------------R-
A0A2K6GWM6_BCL2L2-      PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVN-
A0A2K6GWM6_BCL2L2-      ------------------------FTALYGDGALEEARRLREGNWASVR-
A0A2K6F2Q2_BCL2L10      ------------------------FCDLFRKPLPL----------AVWR-
A0A2K6F6N9_MCL1-01      ---------------------------FFHVEDLE----------GSIR-
A0A2K6GI15_MCL1-03      ------------------------FVEFFHVEDLE----------GGIR-
A0A2K6GI15_MCL1-01      ----------------------------CGVLPCRGPRRRHQKCAAGFCR
A0A2K6G3C5_BCL2L1-      ------------------------FVELYGNNAAAESRKGQERFN-----
A0A2K6G3C5_BCL2L1-      ------------------------FVELYGNNAAAESRKGQERFN-----
A0A2K6G3I7_BCL2-01      ------------------------FVELYGPSM-------RPLFDFSWLS
                                                                          

A0A2K6EKG1_BCL2A1-      -PAWLTFLEVTGKICDMLSLLYS---------------------------
A0A2K6GWM6_BCL2L2-      -RVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVSLCF
A0A2K6GWM6_BCL2L2-      -TVLTGAVALGALVTVGAFFASK---------------------------
A0A2K6F2Q2_BCL2L10      -RLLVQVLLSCFLATTVIYFWTRLL-------------------------
A0A2K6F6N9_MCL1-01      -NVLLAFAGVAGVGAGLTYLIR----------------------------
A0A2K6GI15_MCL1-03      -NVLLAFAGVAGVGAGLAYLIR----------------------------
A0A2K6GI15_MCL1-01      CCWSRSWFGISNKIAL----------------------------------
A0A2K6G3C5_BCL2L1-      -RWFLTGMTVAGVVLLGSLFSRK---------------------------
A0A2K6G3C5_BCL2L1-      -RWFLTGMTVAGVVLLGSLFSRK---------------------------
A0A2K6G3I7_BCL2-01      LKTLLSLALVGACITLGAYLGHK---------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      PLYILYSQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      ---------------------
A0A2K6GWM6_BCL2L2-      SRPRGRVYRGRARATSWYSPY
A0A2K6GWM6_BCL2L2-      ---------------------
A0A2K6F2Q2_BCL2L10      ---------------------
A0A2K6F6N9_MCL1-01      ---------------------
A0A2K6GI15_MCL1-03      ---------------------
A0A2K6GI15_MCL1-01      ---------------------
A0A2K6G3C5_BCL2L1-      ---------------------
A0A2K6G3C5_BCL2L1-      ---------------------
A0A2K6G3I7_BCL2-01      ---------------------
                                             

© 1998-2020Legal notice