Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEATESE
A0A2K6G3I7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLAQRGYEW----DAGDAGAAPPGAAPTP
A0A2K6GWM6_BCL2L2-      ------------------------------------MATPASAPDTRALV
A0A2K6GWM6_BCL2L2-      ------------------------------------MAAAAAAAAAAGAA
A0A2K6GWM6_BCL2L2-      ------------------------------------MAAAAAAAAAAGAA
A0A2K6GI15_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      -MTDCEFGYTHRLVQDYLQYVLRVPQPGSGPSKT----------------
A0A2K6G3C5_BCL2L1-      METPSAINGNPSWHLADSPPANGATGHSSSLDAREVIPMAAV--------
A0A2K6G3I7_BCL2-01      GIFSSQPGRNPPPAAPRDPAARTSPPPAAAAGPAPSPVPPVV--------
A0A2K6GWM6_BCL2L2-      ADFVGYKLRQKGYVCG----AG--------PGEGP--AADPL--------
A0A2K6GWM6_BCL2L2-      GGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGD--YGNGL--------
A0A2K6GWM6_BCL2L2-      GGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGD--YGNGL--------
A0A2K6GI15_MCL1-02      -----MFGLKRNAVIGLNLYCGGAGLGAGSSGATP--PGGRL--------
A0A2K6GI15_MCL1-01      -----MFGLKRNAVIGLNLYCGGAGLGAGSSGATP--PGGRL--------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPL--------
A0A2K6F2Q2_BCL2L10      -MGDRFRERTERLLADYLEYCTREPG-----APGLPPSSLEA--------
A0A2K6F6N9_MCL1-01      -----------DLWINLGISC----G-----RADLGWAWLGL--------
A0A2K6GI15_MCL1-03      -----MFGLKRNAVIGLNLYC----G-----GAGLGAGSSGATPPGGRLL
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------SRVLQNIAF----------SVQNEVEKNLK
A0A2K6G3C5_BCL2L1-      --------------------KQALKEAGD----------EFELRYRRAFS
A0A2K6G3I7_BCL2-01      --------------------HLTLRQAGD----------DFSRRYRRDFA
A0A2K6GWM6_BCL2L2-      --------------------HQAMRAAGD----------EFETRFRRTFS
A0A2K6GWM6_BCL2L2-      --------------------ESEELEPGELLLEPEPEPEPEEEPPRPRAP
A0A2K6GWM6_BCL2L2-      --------------------ESEELEPGD---------------------
A0A2K6GI15_MCL1-02      --------------------LAAEKEATA---------------------
A0A2K6GI15_MCL1-01      --------------------LAAEKEATA---------------------
A0A2K6G3C5_BCL2L1-      ----------------------MQKRTGL----------RPQKRLNRRWR
A0A2K6GWM6_BCL2L2-      --------------------HQAMRAAGD----------EFETRFRRTFS
A0A2K6F2Q2_BCL2L10      ---------------------AAMRFAAT----------KIRRKHASFFS
A0A2K6F6N9_MCL1-01      ----------------------------------------------KAFQ
A0A2K6GI15_MCL1-03      ATGAKDAKPMGRSGAASRKALETLRRVGD----------GVQRNHETAFQ
                                                                          

A0A2K6EKG1_BCL2A1-      ACLDNVNVASIDAARTIFNQVMEKEFEDGIVNWGRIVTVFAFGGILIKKL
A0A2K6G3C5_BCL2L1-      DLTSQLHITL-GTAYQSFEQVVNELFRDGVN-WGRIVAFFSFGGALCVES
A0A2K6G3I7_BCL2-01      EMSSQLHLTP-FTARGRFATVVEELFRDGVN-WGRIVAFFEFGGVMCVES
A0A2K6GWM6_BCL2L2-      DLAAQLHVTP-GSAQQRFTQVSDELFQGGPN-WGRLVAFFVFGAALCAES
A0A2K6GWM6_BCL2L2-      PGAPGPGPGS-GAPGSQEEEEEPGLVEGDPG-DGAI--------------
A0A2K6GWM6_BCL2L2-      ----------------QEEEEEPGLVEGDPG-DGAI--------------
A0A2K6GI15_MCL1-02      -------------RREVGGGEDGTVIGGSPG-ASPPASLTPEARRVARPA
A0A2K6GI15_MCL1-01      -------------RREVGGGEDGTVIGGSPG-ASPPASLTPEARRVARPA
A0A2K6G3C5_BCL2L1-      PPVPLMATHP-GTAYQSFEQVVNELFRDGVN-WGRIVAFFSFGGALCVES
A0A2K6GWM6_BCL2L2-      DLAAQLHVTP-GSAQQRFTQVSDELFQGGPN-WGRLVAFFVFGAALCAES
A0A2K6F2Q2_BCL2L10      AYVG----YP-GNRVYLLERMAEAVLCDSLS-WGRVVMLVTFAGTLLERG
A0A2K6F6N9_MCL1-01      GMLQKLDIKN-EDDVKSLSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHL
A0A2K6GI15_MCL1-03      GMLRKLDIKN-EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHL
                                                 . ..    .                

A0A2K6EKG1_BCL2A1-      LREQIALDVDTYKE---------------ISYFIAEFITNNAGEWIRQNG
A0A2K6G3C5_BCL2L1-      VDKE-------MQVLVSR-----------IATWMATYLNDHLEPWIQENG
A0A2K6G3I7_BCL2-01      VNRE-------MSPLVDN-----------IALWMTEYLNRHLHTWIQDNG
A0A2K6GWM6_BCL2L2-      VNKE-------MEPLVGQ-----------VQEWMVAYLETRLADWIHSSG
A0A2K6GWM6_BCL2L2-      -------------------------------------------------E
A0A2K6GWM6_BCL2L2-      -------------------------------------------------E
A0A2K6GI15_MCL1-02      PIGA-------EVPDVTA-----------TPERLLFFAPTRRALPSEEME
A0A2K6GI15_MCL1-01      PIGA-------EVPDVTA-----------TPERLLFFAPTRRALPSEEME
A0A2K6G3C5_BCL2L1-      VDKE-------MQVLVSR-----------IATWMATYLNDHLEPWIQENG
A0A2K6GWM6_BCL2L2-      VNKE-------MEPLVGQ-----------VQEWMVAYLETRLADWIHSSG
A0A2K6F2Q2_BCL2L10      PPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQAQG
A0A2K6F6N9_MCL1-01      KTIN---QESCIEP---------------LAESITDILVRTKRDWL----
A0A2K6GI15_MCL1-03      KSIN---QESCIEP---------------LAESITDVLVRTKRDWLVKQR
                                                                          

A0A2K6EKG1_BCL2A1-      GWEHG---------------------------------------------
A0A2K6G3C5_BCL2L1-      GWDT----------------------------------------------
A0A2K6G3I7_BCL2-01      GWDA----------------------------------------------
A0A2K6GWM6_BCL2L2-      GWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEE
A0A2K6GWM6_BCL2L2-      DPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEE
A0A2K6GWM6_BCL2L2-      DPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEE
A0A2K6GI15_MCL1-02      APAADAIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE
A0A2K6GI15_MCL1-01      APAADAIMSPEDELD-----------------GYEPEPLGKRPAVLPLLE
A0A2K6G3C5_BCL2L1-      GWDT----------------------------------------------
A0A2K6GWM6_BCL2L2-      GWAE----------------------------------------------
A0A2K6F2Q2_BCL2L10      GWDG----------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      GWDG----------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      ---------FVKKFEP-----------------RPAWLTFLEVTGKICDM
A0A2K6G3C5_BCL2L1-      ---------FVELYGNNAAAE-----------------------------
A0A2K6G3I7_BCL2-01      ---------FVELYGPSM--------------------------------
A0A2K6GWM6_BCL2L2-      KMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF
A0A2K6GWM6_BCL2L2-      KMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF
A0A2K6GWM6_BCL2L2-      KMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF
A0A2K6GI15_MCL1-02      ---------LVGEASNGSSTD----------------------GSLPSTP
A0A2K6GI15_MCL1-01      ---------LVGEASNGSSTD----------------------GSLPSTP
A0A2K6G3C5_BCL2L1-      ---------FVELYGNNAAAESRKGQ----ERFNRWFLTGMTVAGVVLLG
A0A2K6GWM6_BCL2L2-      ---------FTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVG
A0A2K6F2Q2_BCL2L10      ---------FCDLFRKPLPL----------AVWRRLLVQVLLSCFLATTV
A0A2K6F6N9_MCL1-01      ------------FFHVEDLE----------GSIRNVLLAFAGVAGVGAGL
A0A2K6GI15_MCL1-03      ---------FVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGL
                                                                          

A0A2K6EKG1_BCL2A1-      LSLLYS--------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTNRP
A0A2K6GWM6_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTNRP
A0A2K6GWM6_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTNRP
A0A2K6GI15_MCL1-02      PPAEEEDDELYRQSLEIISRYLREQATG----------------------
A0A2K6GI15_MCL1-01      PPAEEEDDELYRQSLEIISRYLREQATG----------------------
A0A2K6G3C5_BCL2L1-      SLFSRK--------------------------------------------
A0A2K6GWM6_BCL2L2-      AFFASK--------------------------------------------
A0A2K6F2Q2_BCL2L10      IYFWTRLL------------------------------------------
A0A2K6F6N9_MCL1-01      TYLIR---------------------------------------------
A0A2K6GI15_MCL1-03      AYLIR---------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ----SRKGQERFN------RWFLTGMTVAGVVL-----------------
A0A2K6G3I7_BCL2-01      --------RPLFDFSWLSLKTLLSLALVGACIT-----------------
A0A2K6GWM6_BCL2L2-      GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR----
A0A2K6GWM6_BCL2L2-      GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR----
A0A2K6GWM6_BCL2L2-      GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR----
A0A2K6GI15_MCL1-02      ----AKDAKPMGRSGAASRKALETLRRVGDGVQ-RNHETAFQGMLRKLDI
A0A2K6GI15_MCL1-01      ----AKDAKPMGRSGAASRKALETLRRVGDGVQ-RNHETAFQGWVC----
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6GI15_MCL1-02      KNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCI
A0A2K6GI15_MCL1-01      ---------------------------------GVLPCRGPRR-RHQKCA
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ---------------------LGSLFSRK---------------------
A0A2K6G3I7_BCL2-01      ---------------------LGAYLGHK---------------------
A0A2K6GWM6_BCL2L2-      ---------------------ATSWYSPY---------------------
A0A2K6GWM6_BCL2L2-      ---------------------ATSWYSPY---------------------
A0A2K6GWM6_BCL2L2-      ---------------------ATSWYSPY---------------------
A0A2K6GI15_MCL1-02      EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAG
A0A2K6GI15_MCL1-01      AGFCRCC----------W---SRSWFGISNKIAL----------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6EKG1_BCL2A1-      -------------
A0A2K6G3C5_BCL2L1-      -------------
A0A2K6G3I7_BCL2-01      -------------
A0A2K6GWM6_BCL2L2-      -------------
A0A2K6GWM6_BCL2L2-      -------------
A0A2K6GWM6_BCL2L2-      -------------
A0A2K6GI15_MCL1-02      VAGVGAGLAYLIR
A0A2K6GI15_MCL1-01      -------------
A0A2K6G3C5_BCL2L1-      -------------
A0A2K6GWM6_BCL2L2-      -------------
A0A2K6F2Q2_BCL2L10      -------------
A0A2K6F6N9_MCL1-01      -------------
A0A2K6GI15_MCL1-03      -------------
                                     

© 1998-2020Legal notice