Dataset for protein BCL-2-like of organism Pelodiscus sinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
      msntmesseirfvy lv    hs swf gq-ylryiaq-ee   sv ngspswhpgashvvng  ghsns eah
             l fd ls               e eikte a                                    

        90       100       110       120       130       140       150       160
                                 * :.        .  *    * **  *****:::: **. :.    .
------------r---------------pllst diksvedyrsivsq mtkv s  nt     ltlis  ailskrlqs
egvpasr rqv -nsasflqlenreilsgctrk    ngd lq   is anhe d  iv       i m   fva h ke
  p  ae aha  e     ek  e a kd  d     le  ak     d                     a      d

       170       180       190       200       210       220       230       240
 : .   .    ::  :*  :      *:  : **                                             
knvqvtintkeqlsyii tvivstkrp lvnqr  -g--elygnnmrpmfrksqswlsvtn-tgaivnavvtlgsylgrk
ikqencggr     sf   tnd de  de    dra svl sgflalsefkwisfrrglislstrgvlslfsqlyslg
h   l   n          id  ad   a    aa  dff  daa k deg eq nlfi kaklmdgflf agfa h 
                                                          ked e    a cia  a     

© 1998-2022Legal notice