Dataset for protein BCL-2-like of organism Pelodiscus sinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------ydnre------lvlkylhyklsqrg--w---e-----------ssslsp---g-ps-h-g---------g--
mahpgrrg-----fryvyyi--d-i--------yd-aan-nrgpvrteaaee-e---paa-t--d-a-lvslppepp-sa
      msntss       - q-f-s i q   hs swf gedei      -p-mgsvpn s  w p ashvvngaa hs
        me           i   k                          a  a                        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           * :.        .  *    * **  *****:::: *
------l----r-apqavhltlrqagdefsrryhrdfaqmsgqLhitpftargr-fvqVveelFrDG-tNWGRIvaffsF
aasnvp-gdgl-s---------c---------------pllst dlksvedyrsivsa mtkv s  ni     ltlie 
ns     eahe vpasr rqv -nsasflqlenreilsgctrk    ngd lq   is anhe d  iv       i m 
               ae aha  e     ek  e a kd  d     le  ak     d                   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. :.    . : .   .    ::  :*  :      *:  : **    : .                            
Ggvmcvesvnremsplvds---iavwmTeylnrhlhnWiqdngGWe-gfvelyg----------------g-lsla-v-a
 ailskrlqsknvqvtintkeqlsyii tvivstkrp lvnqr  dnralsvf-vnmrplsrrswlvlnr-w----t-l-
  fva h keikqencggr     sf   tnd de  de    a a  pmlrskdlekfiknvisffqtlatggnskg
  a      dh   l   n          id  ad   a         df eneaaag dfgqeqa ksi g flig 
                                                      ed             a f    a a 

       250   
....:....|...
             
-iml---------
y---gsylsskyy
vmtrafsfgrq  
klld al fh   
c            
© 1998-2020Legal notice