Dataset for protein BCL-2-like of organism Pelodiscus sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7FPN7_MCL1-01        --------------------------------------------------
K7G130_BCL2A1-01      --------MESSEFRYVYYLVQDYLKYILQ--------------------
K7F5Y3_BCL2-03        MAHPGRRGYDNRE------IVLKYIHYKLSQRGYDWAANENRGPV-----
K7F655_BCL2L1-01      ------MSNTNRE------LVIDFLSYKLSQRGHSWSWFEGEDEIRTEAA
K7F5Y3_BCL2-01        MAHPGRRGYDNRE------IVLKYIHYKLSQRGYDWAANENRGPV-----
K7F5Y3_BCL2-02        MAHPGRRGYDNRE------IVLKYIHYKLSQRGYDWAANENRGPV-----
                                                                        

K7FPN7_MCL1-01        --------------------------------------------------
K7G130_BCL2A1-01      -EPELGP------------------------------------APSRVAH
K7F5Y3_BCL2-03        -SSSLSPPAAGS-----------------AAASNVPLGDGLRSAPQAVHL
K7F655_BCL2L1-01      EEAEMASVPNGSPSWHPGASHVVNGAAGHSNS----LEAHERVPAAEVRQ
K7F5Y3_BCL2-01        -SSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLRSAPQAVHL
K7F5Y3_BCL2-02        -SSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLRSAPQAVHL
                                                                        

K7FPN7_MCL1-01        ------------------GMLRKLDIKNEEDLKS-VSSVATHVFSDGITN
K7G130_BCL2A1-01      VLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFDDGNTN
K7F5Y3_BCL2-03        TLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-IN
K7F655_BCL2L1-01      ALREAGDEFELRYRRAFSDLTSQLHITLGTAYQS-FEQVVNELFRDG-VN
K7F5Y3_BCL2-01        TLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-IN
K7F5Y3_BCL2-02        TLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-IN
                                             * :.        .  *    * **  *

K7FPN7_MCL1-01        WGRIVTLISFGAFVAKHLKSINQENCINT---LAGIITDVLVSDKRDWLV
K7G130_BCL2A1-01      WGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWID
K7F5Y3_BCL2-03        WGRIVAFFEFGGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQ
K7F655_BCL2L1-01      WGRIVAFFSFGGALCVESVDKEMQVLVGR---IASWMTTYLTDHLDPWIQ
K7F5Y3_BCL2-01        WGRIVAFFEFGGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQ
K7F5Y3_BCL2-02        WGRIVAFFEFGGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQ
                      ****:::: **. :.    . : .   .    ::  :*  :      *: 

K7FPN7_MCL1-01        NQRGWEGFVEFF---------------RVEDLEGSIRNVLVAFAGFAGLG
K7G130_BCL2A1-01      ANGGWE-------NGFLPMFEEKQSWLSLFNIKAKIMDAFSFFSQYY---
K7F5Y3_BCL2-03        DNGGW---------------------------------------------
K7F655_BCL2L1-01      ENGGWERFVDLYGNDAAAKSRKGQEQFNRGLLTGATVAGVLLLGSLLSRK
K7F5Y3_BCL2-01        DNGGWDAFVELYGSNMRPLFDFSWISL-KTILSLALVGACITLGAYLGHK
K7F5Y3_BCL2-02        DNGGWAGAVSVL--------------------------------------
                       : **                                             

K7FPN7_MCL1-01        ASLAYMMR
K7G130_BCL2A1-01      --------
K7F5Y3_BCL2-03        --------
K7F655_BCL2L1-01      --------
K7F5Y3_BCL2-01        --------
K7F5Y3_BCL2-02        --------
                              

© 1998-2022Legal notice