Dataset for protein Mcl-1 of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLatekeasarreigggeagtviggsagasppaaltpdarrvarpp
                                    --------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaevpdvtatparplffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesgnspstdgsl
--------------------------------------------------------------------------------
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************************
pstpppaeeeedelyrqsleiiswylreqATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
-----------------------------                                                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************************    .   
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWdgfvsffv
                                                                        gktcessh
                                                                        ai   pl 

       330       340       350
....:....|....:....|....:....|
                 :. : .       
vedleggirnvllafagvagvga-------
----------------rmcilwsglaylir
eyssvdsnheeishqgfi eihg       
© 1998-2023Legal notice