Dataset for protein Mcl-1 of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MRS6_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------------
A0A096MRS6_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A096MRS6_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A096MRS6_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
                        ************************************              

A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096MRS6_MCL1-01      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFA
A0A096MRS6_MCL1-04      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFA
A0A096MRS6_MCL1-02      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFA
                                                                          

A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096MRS6_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A096MRS6_MCL1-04      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A096MRS6_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                                                                          

A0A096MRS6_MCL1-03      ---------------------------------------ATGAKDTKPMG
A0A096MRS6_MCL1-01      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMG
A0A096MRS6_MCL1-04      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMG
A0A096MRS6_MCL1-02      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMG
                                                               ***********

A0A096MRS6_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A096MRS6_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A096MRS6_MCL1-04      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A096MRS6_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A096MRS6_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A096MRS6_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A096MRS6_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A096MRS6_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                        **************************************************

A0A096MRS6_MCL1-03      TKRDWLVKQRGWDGF----VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLA
A0A096MRS6_MCL1-01      TKRDWLVKQRGWGKTCSPLV---------------------------FMC
A0A096MRS6_MCL1-04      TKRDWLVKQRGWAIFCSSSVEYSSVDSNHEEISH-----------QGRIA
A0A096MRS6_MCL1-02      TKRDWLVKQRGWDGF----VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLA
                        ************       *                            :.

A0A096MRS6_MCL1-03      YLIR
A0A096MRS6_MCL1-01      ILWG
A0A096MRS6_MCL1-04      EIHS
A0A096MRS6_MCL1-02      YLIR
                         :  

© 1998-2022Legal notice