Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----efgy---------iy------------------rLaqdgl-y---yp-gpgsgpss-sa----------------
mmtdc----tralvvdfv--yggaglgagsggatppggk-srky-q-vnqivgqa-ptegqtgrtsemetpsaingnpsw
 ahpasapdnnreparlymfc                 g ranaykwlllsgc--nlaa-ppa-d             m 
 veqwrtrtkmndilmkrgh                  - l---vigtqr-cvtvea--r-g-tp               
 edegmsqsd ea igente                  e kntvesqskpm- rs - spvivse               
   a  kll        ls                     - r agdmamed pe r gltemp                
      e k         l                     q e  e c fa  e  n  akale                
                                                 d   d        e                 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------alravgdevqrrvernfssmlaqlhvtpgdtars--ftvvekeffdggp
krtgsrpvngatghsssldarevipmapvhqv-qnaafsfskeyrktlkeladnvngvsvtayqtlfnqqmsdrlerrii
hladlpaqk                  vpgg-ml-----aet-rhigggdcgsvigisnfssvprratetpvsvrvqdv-
                           alkltv-rtekg--aqi tavqgayrs----aeayqalm aleldnsp-a-pv
                               r  qs adrn-nf psmpadttkyylnr -lpkg  ss  ihl sp -t
                                  e   alll w ep f  slh p k  edg    dr   eh rh cg
                                           h  k e    g d g              a  g    
                                              d a                               
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .  .                                                                          
nwGriVtf----------fafggalcke---------------svrkemapdvstyqewmyfyaetrlnnt---------
pinavtalcdkfsghpkg-s-eai-ivkgplvttrwkkwgfqpll--qi-vledrikaisltvlpflma-plhssggwaa
tv  l -i          v-y---v---               --nq--qnvatqvprrlaaftndivrd-ieemeapel
  e i-          iv iefslar               r dtstelq gataplavwmssyhreaw        e
                   t a vmdeh                 krklsd  r---n vislidv tgtl         
                   e   t a                    e ei    lfrg qeli  r n rk         
                                                 g    dce    k   k   qh         
                                                      c              h          
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
daimspeeelegyepeplgkrpavlpllelvgesgnntstdgslpstpppaeeeedelyrqsleiisrylreqatgakdt
ftalyrvramdeerrlre nwas rtvk  qn vekqmnmspppgnag vimsi ekmeadars yvgnvdyg  aeele
e  kagdg    aaek                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
kpmgrsgatsrkaletlrrvghpkgfayiefsdkdgvqrnlalhetafqgwlvkvdiknedivkstsrvmisvtsrgvtr
ahfhgc svn vtilcdkfs              es rts   tgsvar rvrtl      dp rln pg htpdd prn
                                           d al l mqig                  lfc  fp 
                                                  a c                           
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       :                        
------------------------------------------g-----------ewiqqnggwd-------gfve-f---
wryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkristtdrgfprasylrkq----nwrshtp----l-ghn
agriarlinfgafrakflkgf qqprgeplcgrctd      -           pffve-rnyesshn   tlykfyhve
                      hee aagfaecara      t           d ya-yt  nk      r cskvenr
                                          h           a r-st   g       m  hs rtp
                                                      t  srk           a   g ns 
                                                      r   p                  ap 
                                                          d                     
                                                          a                     

       490       500       510       520       530        
....:....|....:....|....:....|....:....|....:....|....:...
                                                          
------k---------l----v-g-------l--------------------------
dlegsrrsqerfnrww-tfmt-a-vvlllay-srkyylgtklifltvmetiantyfyf
aaaegi-ng      lmallgstsliaggslfittplcehg                 
srrrvydkv      fvsgaelllkgtvmltrwlrlc                     
pplplw gs      k qakl c itskiisitkqa                      
fmgaff fr          f     snif c ldg                       
                         ace    k                         
                           a                              
                                                          
© 1998-2020Legal notice