Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------t--efgy---------iy------------------rl-q
msqsnrelvvdflsyklsqkgyswsqftpvseprtrapmm-dcm--lkrnaviglnlhyggaglgagsggatppgg--a-
                         masdaeand e lvadearyrttsalpvrpy--c                 ktla
                                      evhqw-tp-rqrinlnkvwk                  lass
                                       gepvsmlkpnkgigmfste                  e rn
                                       e fsgkkddm e aderg                     ql
                                         ag ee    d    m                      g 
                                            a                                 d 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     .        . 
dyl-----ipgpgsgpsstsr-----vlraagdevqrrvernfssmlaqlhvtp-gtartlfnqvmeelfrdgp--nwGr
---qyvlqcgqa-laagq-patpvhqa-qnvafsfskeyrktlkeladnvnlvsvdssyqs-atpvdkeverpvippina
rgykgtvr---spe--pvigepvpgg-m------let-r igggdcgsviyisnp-avqprttrmssrvlsgsig tv  
tvvnwmtpvss-latt--g--dalklt lstekra-anh tavqaa-r--gggaf yrps-vllednsr qh ct s   
ppqgqcnmscrv -psrppvsa  aar  r  ag-r-if spmpg-t-s ---ye ngkg  ee lihh a         
kaeedakgmapt p rlkdmp        q   d nq w pk e dstk d k   d fe  s  a a  -         
e a   adh d  n geaalm        e      l i ef a    h         a                     
       cg    d ea  al                    d                                      
        e                                                                       
        a                                                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .                                                        :                     
iVtf----------fafggalcke---------------svrkemapdvs---riaawmaeylntrlg-----------e
vtalcdkfsghpkg-s-eai-ivkgplvttrwkkwgfqpll--qi-vledtykevsyfvvtfimnntaisttdrgfprad
l -i          v-y---v---               --nq--qnvatlirqtqerltfvavrhrr           a
e i-          iv iefslar               r dtstelq gdfqalplsilarrpdtpe           p
               t a vmdeh                 krklsd  rcceprvil ssk egqkh           t
               e   t a                    e ei       n   k ip  t  h            r
                                             g       g      d                   
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
wiqenggwd-------gfvelfgh-a-e---k-sgwlnlleltget-agvsllgsl------------------------
plrqseapendaimtptpekeyeny-p-plrrrqr-m-f--v----v---------ystpppaeeeedelyrqsleiisr
yrhsqtnyaawrsk  sryskldgnelaesg-gpev-trwf-vtvstnntytdttppcrkkvisstvmktiantysyyvg
  ermr  nsshnh  altrfvrvesarrvyd karfp-ktsrsmiggllvrwrrvfvgtgl mli e me darf f  
  vkt   gle     r chsmntrprlggw  --lvawas qnlvsvqatmtpqatnehff fk               
  ad     k      m  ag hspfmkafi  nvkgsafl llkllkmmnislp llag                    
   a            e     apgdeg af  lse q  g c  geific kkl g  a                    
                       e         fq       a  acea a idg                         
                       d                      a     ga                          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ylreqatgakdtkpmgrsgatsrkaletlrrvghpkgfayiefsdkdgvqrnlalhetafqgwvrkvdiknedivkstsr
nvdyg  aeeleahfhgc svn vtilcdkfs              es rts   d sl r rqigl      dp rln 
                                                              mlc               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vmisvtsrgvtrwryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkrswyvpyrgwdgfveffhvedleggi
pg htpdd prnagriarlinfgafrakflkgf qqprgeplcgrctd      td lskq                   
    lfc  fp                       hee aagfaecara         f                      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500  
....:....|....:....|..
                      
----------------------
rnvllafagvagvsnklaylir
            igagi l   
                      
                      
                      
                      
                      
                      
                      
© 1998-2021Legal notice