Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------t-atgpdtrrlvadylgyklr-------gyvwgagsg------------------
mfglkrnaviglnlyvgqwrlrtmm-d-sfgynya-a--fvq----eigggqk--ipqp-p-gsppstltpestrverpt
              mcdgagegmtaapcea--i-ev-qk-i-svrs     er a-c--s-vveenr ea dgresamep
                      agsggr--ys-n-ilvek-sln q     cg cs-sqftpe                 
                       ah  pmsqrrel  t  eh a y      a  greg dda                 
                           mlrlkg    m   a             eld  a                   
                            fpeg                       ai                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------e-p----------------------------------------------
psginvppvwkttgsrpvngptrrsssleer-t-aadplmspeeeldgyepeplgkrpavlpllelvgesgnntstdgsl
 iaaegndsthrpdrplqkaa ghaap damagipmgav                                         
        m alaallaff            pa  gari                                         
                                v                                               
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .       .            
-------------------------------------------------hqvlrragdevqrrhrrafssmlsqlhvtp-
pstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatssqtsrtmqnvafsfetnyettlqdlarn--ivsv
                            l            lspvprkalea--a---glskev knvkgctdkvn-kn 
                                              tvv---  -  a- rqif sp peysa- dl-  
                                              ppekl   s   r nl w pf aa  th   y  
                                                 aa   q   d       d     g       
                                                      e                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .  :    : ..   .***:*::. * . :                         :          :   :   
gtarqsftqVmeelFsdG--pNWGRiVtffsFggal------------------ckesvnkemeplvd---riaewmaey
esdytrlsrmvdkvlrgsvgvt   l aliv eaivlergplvttrwkkwgfqpivklltqqqavdistykqlsasvttv
ddrvklvnt snhe q  i t    v  iva a fm                  aahekriniqsccg   pvqyfivdf
fn qg  el ais  e  p i         t   v                   rl  qdrdvsr  e   e vlllsar
   fe             -         e   t                        eg      q   n      s 
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:      *:  . **                                                                 
lvrhlrdWiqsngGWd----------------------------------------------------------gfvely
intttgp lvqqr  eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeanwrtiyytngkff
 mnrkee  rks   g                                                   kehshtvmlchy-
 ednhat  he    a                                                   dafnalpad dsv
  gq ha   d                                                                  akg
          a                                                                    e
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ghne-pear----grinrvllalatvagvgalgayl--------------------------------------------
etkarlmsfwkgqegvrnwf-tgml------g----srkdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfp
an--aal-dlevv--fl---vsf-gyvahvl-lslflhs    i                                    
--vslwvt-fsstwt--tttslcl-tttfiyfftskif                                          
rpsrgr gn r crssvqmai--kqls cpt w rig                                           
farmek fl h  kqlckg    gkfg   k     e                                           
  pkdh eh a   l  ea    da c                                                     
  af          k                                                                 

       490       500       510       520    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
raryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                            
                                            
                                            
                                            
                                            
                                            
© 1998-2020Legal notice