Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9A2Q3_BCL2L2-      -------------------------MATPASAPDTRALVADFVGYKLRQK
A0A2R9BPJ5_MCL1-01      -------------------------------------------MFGLKRN
A0A2R9BPJ5_MCL1-02      -------------------------------------------MFGLKRN
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A2R9BCD9_BCL2L10      --------------------------------------MVDQWRERTTMA
A0A2R9A2Q3_BCL2L2-      --------------------------------------MATPASAPDTRA
A0A2R9A2Q3_BCL2L2-      --------------------------------------MEEEAEKLK---
A0A2R9APW6_BCL2-01      --------------------------------------MAHAGRTGYDNR
A0A2R9BPJ5_MCL1-03      -------------------------------------------MFGLKRN
A0A2R8ZJ66_BCL2A1-      ---------------------------------------MTDCEFGY---
A0A2R8ZJ66_BCL2A1-      ---------------------------------------MTDCEFGY---
A0A2R8ZJ66_BCL2A1-      ---------------------------------------MTDCEFGY---
                                                                          

A0A2R9A2Q3_BCL2L2-      G------Y------------------------------VCGAGPGEGP-A
A0A2R9BPJ5_MCL1-01      AVIGLNLY------------------------------CGGAGLGAGSGG
A0A2R9BPJ5_MCL1-02      AVIGLNLY------------------------------CGGAGLGAGSGG
A0A2R8Z9D7_BCL2L1-      -----MWK------------------RTGLRPQKG---------------
A0A2R8Z9D7_BCL2L1-      INGNPSWH------------------LADSPAVNGATGHSSSLDAREVIP
A0A2R9BCD9_BCL2L10      DPLRERTE------------------RLLADYLGYCAREPGTPEPTPSTP
A0A2R9A2Q3_BCL2L2-      LVADFVGY------------------KLRQKGY---VCGAGPGEGPAADP
A0A2R9A2Q3_BCL2L2-      --------------------------ELQNEVEKQMNMSPPPGNAGPVIM
A0A2R9APW6_BCL2-01      EIVMKYIHY-----------------KLSQRGYEW--DAGDVGAAPLSPV
A0A2R9BPJ5_MCL1-03      AVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKAL
A0A2R8ZJ66_BCL2A1-      ------IY------------------RLAQDYLQYVLQIPQPGSGPSQTS
A0A2R8ZJ66_BCL2A1-      ------IY------------------RLAQDYLQYVLQIPQPGSGPSQTS
A0A2R8ZJ66_BCL2A1-      ------IY------------------RLAQDYLQYVLQIPQPGSGPSQTS
                                                                          

A0A2R9A2Q3_BCL2L2-      ADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELF
A0A2R9BPJ5_MCL1-01      ATPPGGRLLATEKEASARREIGGGEAGAVIGGSA-GASPPSTLTPDSRRV
A0A2R9BPJ5_MCL1-02      ATPPGGRLLATEKEASARREIGGGEAGAVIGGSA-GASPPSTLTPDSRRV
A0A2R8Z9D7_BCL2L1-      --------------LNRRWRPPVPSMATH----P-GTAYQSFEQVVNELF
A0A2R8Z9D7_BCL2L1-      MAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELF
A0A2R9BCD9_BCL2L10      E---AAVLRSAAARLRQIHRSFFSA-----YLGYPGNRFELVALMADSVL
A0A2R9A2Q3_BCL2L2-      L---HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELF
A0A2R9A2Q3_BCL2L2-      S-----------------IEEKMEADARSIYVGNVDYGAT--AEELEAHF
A0A2R9APW6_BCL2-01      PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVEELF
A0A2R9BPJ5_MCL1-03      E-----TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVF
A0A2R8ZJ66_BCL2A1-      R-----VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF
A0A2R8ZJ66_BCL2A1-      R-----VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF
A0A2R8ZJ66_BCL2A1-      R-----VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF
                                                                         .

A0A2R9A2Q3_BCL2L2-      QGGP--NWGRLVAF----------FVFGAALCAE---------------S
A0A2R9BPJ5_MCL1-01      ARPP--PIGAEV--------------------------------------
A0A2R9BPJ5_MCL1-02      ARPP--PIGAEV--------------------------------------
A0A2R8Z9D7_BCL2L1-      RDGV--NWGRIVAF----------FSFGGALCVE---------------S
A0A2R8Z9D7_BCL2L1-      RDGV--NWGRIVAF----------FSFGGALCVE---------------S
A0A2R9BCD9_BCL2L10      SDSPGPTWGRVVTL----------VTFAGTLLERGPLVTTRWKKWGFQPR
A0A2R9A2Q3_BCL2L2-      QGGP--NWGRLVAF----------FVFGAALCAE---------------S
A0A2R9A2Q3_BCL2L2-      -HGCG-SVNRVTILCDKFSGHPKGFAYIEFSDKE---------------S
A0A2R9APW6_BCL2-01      RDGV--NWGRIVAF----------FEFGGVMCVE---------------S
A0A2R9BPJ5_MCL1-03      SDGVT-NWGRIVTL----------ISFGAFVAKH---------------L
A0A2R8ZJ66_BCL2A1-      EDGII-NWGRIVTI----------FAFEGILIKK---------------L
A0A2R8ZJ66_BCL2A1-      EDGII-NWGRIVTI----------FAFEGILIKK---------------L
A0A2R8ZJ66_BCL2A1-      EDGII-NWGRIVTI----------FAFEGILIKK---------------L
                                .  .                                      

A0A2R9A2Q3_BCL2L2-      VNKEMEPLVG---QVQEWMVAYLETRLA-----------DWIHSSGGWEL
A0A2R9BPJ5_MCL1-01      ------PDVT---ATPARLLFFAPTRRA-----------APLEEMEAPAA
A0A2R9BPJ5_MCL1-02      ------PDVT---ATPARLLFFAPTRRA-----------APLEEMEAPAA
A0A2R8Z9D7_BCL2L1-      VDKEMQVLVS---RIAAWMATYLNDHLE-----------PWIQENGGWD-
A0A2R8Z9D7_BCL2L1-      VDKEMQVLVS---RIAAWMATYLNDHLE-----------PWIQENGGWD-
A0A2R9BCD9_BCL2L10      LKEQEGDVARDCQRLVALLSSRLVGQHR-----------AWLQAQGGWD-
A0A2R9A2Q3_BCL2L2-      VNKEMEPLVG---QVQEWMVAYLETRLA-----------DWIHSSGGWA-
A0A2R9A2Q3_BCL2L2-      VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A2R9APW6_BCL2-01      VNREMSPLVD---NIALWMTEYLNRHLH-----------TWIQDNGGWD-
A0A2R9BPJ5_MCL1-03      ---KTINQESCIEPLAESITDVLVRTKR-----------DWLVKQRGWD-
A0A2R8ZJ66_BCL2A1-      LRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQNGGWGK
A0A2R8ZJ66_BCL2A1-      LRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQNGGWEN
A0A2R8ZJ66_BCL2A1-      LRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQNGGWEN
                                          :                               

A0A2R9A2Q3_BCL2L2-      EAIK--ARVREMEEEAEK----------LKELQNEVEKQMNMSPPPGNAG
A0A2R9BPJ5_MCL1-01      DAIM--SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTP
A0A2R9BPJ5_MCL1-02      DAIM--SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTP
A0A2R8Z9D7_BCL2L1-      ------TFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2R8Z9D7_BCL2L1-      ------TFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2R9BCD9_BCL2L10      ------GFCHFFRTPFPLAFWR-KQLVQAFLSCLLTTAFIYLWTRLL---
A0A2R9A2Q3_BCL2L2-      ------EFTALYGDGALEEARR-LREGNWASVRTVLTGAVALGALVTVGA
A0A2R9A2Q3_BCL2L2-      SRS---RFYSGFNSRPRGRVYR-SG-------------------------
A0A2R9APW6_BCL2-01      ------AFVELYGP-SMRPLFD-FSWLSLKTLLSLALVGACITLGAYLGH
A0A2R9BPJ5_MCL1-03      ------GFVEFFHVEDLEGGIR-NVLLAFAGVAGVGAGLAYLIR------
A0A2R8ZJ66_BCL2A1-      WHNHTPMLVESVAH-------K-KRKMAL---------------------
A0A2R8ZJ66_BCL2A1-      ------GFVKKFEH-------K-SGWMTFLEVTGKICEMLSLLKQ-YC--
A0A2R8ZJ66_BCL2A1-      ------GFVKKFEH-------K-SGWMTFLEVTGKISILLTRKDTPYCET
                                                                          

A0A2R9A2Q3_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A2R9BPJ5_MCL1-01      PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLR
A0A2R9BPJ5_MCL1-02      PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLR
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      FFASK---------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      K-------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      GLIFLTVMETIANTYFYF--------------------------------
                                                                          

A0A2R9A2Q3_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNR
A0A2R9BPJ5_MCL1-01      RVG-------------DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSR
A0A2R9BPJ5_MCL1-02      RVG-------------DGVQRN---HETAFQGWVCGV-------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
                                                                          

A0A2R9A2Q3_BCL2L2-      PGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA--
A0A2R9BPJ5_MCL1-01      VMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVL
A0A2R9BPJ5_MCL1-02      ----LPCRGPRRW---------------------HQECAAGFCRCCWS--
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
                                                                          

A0A2R9A2Q3_BCL2L2-      ----TSWYSPY---------------------------------------
A0A2R9BPJ5_MCL1-01      VRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYL
A0A2R9BPJ5_MCL1-02      ----RSWF---------------------------------GISNKIALL
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
                                                                          

A0A2R9A2Q3_BCL2L2-      --
A0A2R9BPJ5_MCL1-01      IR
A0A2R9BPJ5_MCL1-02      --
A0A2R8Z9D7_BCL2L1-      --
A0A2R8Z9D7_BCL2L1-      --
A0A2R9BCD9_BCL2L10      --
A0A2R9A2Q3_BCL2L2-      --
A0A2R9A2Q3_BCL2L2-      --
A0A2R9APW6_BCL2-01      --
A0A2R9BPJ5_MCL1-03      --
A0A2R8ZJ66_BCL2A1-      --
A0A2R8ZJ66_BCL2A1-      --
A0A2R8ZJ66_BCL2A1-      --
                          

© 1998-2022Legal notice