Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      MVDQWRERTTMADPLRERTE------------------RLLADY---LGY
A0A2R9A2Q3_BCL2L2-      MATPASAPDTRALVADFVGY------------------KLRQKG---Y--
A0A2R9A2Q3_BCL2L2-      MEEEAEKLK-----------------------------ELQNEV---EKQ
A0A2R9APW6_BCL2-01      MAHAGRTGYDNREIVMKYIHY-----------------KLSQRG---YEW
A0A2R9BPJ5_MCL1-03      -----MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATG---AKD
A0A2R8ZJ66_BCL2A1-      -MTDCEFGY---------IY------------------RLAQDY---LQY
A0A2R8ZJ66_BCL2A1-      -MTDCEFGY---------IY------------------RLAQDY---LQY
A0A2R8ZJ66_BCL2A1-      -MTDCEFGY---------IY------------------RLAQDY---LQY
A0A2R8Z9D7_BCL2L1-      -----MSQSNRELVVDFLSY------------------KLSQKGYSWSQF
A0A2R9A2Q3_BCL2L2-      MATPASAPDTRALVADFVGY------------------KLRQKG------
A0A2R9BPJ5_MCL1-02      ------------------MF------------------GLKRNAVIGLNL
A0A2R9BPJ5_MCL1-01      ------------------MF------------------GLKRNAVIGLNL
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      CAREPGTPEPTPSTPE----------------------------------
A0A2R9A2Q3_BCL2L2-      -VCGAGPGEGPAADPL----------------------------------
A0A2R9A2Q3_BCL2L2-      MNMSPPPGNAGPVIMS----------------------------------
A0A2R9APW6_BCL2-01      --DAGDVGAAPLSPVPPV--------------------------------
A0A2R9BPJ5_MCL1-03      TKPMGRSGATSRKALE----------------------------------
A0A2R8ZJ66_BCL2A1-      VLQIPQPGSGPSQTSR----------------------------------
A0A2R8ZJ66_BCL2A1-      VLQIPQPGSGPSQTSR----------------------------------
A0A2R8ZJ66_BCL2A1-      VLQIPQPGSGPSQTSR----------------------------------
A0A2R8Z9D7_BCL2L1-      SDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDA
A0A2R9A2Q3_BCL2L2-      YVCGAGPGEGP-AADP----------------------------------
A0A2R9BPJ5_MCL1-02      YCGGAGLGAGSGGATP----------------------------------
A0A2R9BPJ5_MCL1-01      YCGGAGLGAGSGGATP----------------------------------
                                                                          

A0A2R8Z9D7_BCL2L1-      -----------MWKRTGLRPQKGLNRRWRPPVPSMATHP-GTAYQSFEQV
A0A2R9BCD9_BCL2L10      ---------AAVLRSAAARLRQIHRSFFSA-----YLGYPGNRFELVALM
A0A2R9A2Q3_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQV
A0A2R9A2Q3_BCL2L2-      -----------------------IEEKMEADARSIYVGNVDYGAT--AEE
A0A2R9APW6_BCL2-01      --------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATV
A0A2R9BPJ5_MCL1-03      -----------TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRV
A0A2R8ZJ66_BCL2A1-      -----------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
A0A2R8ZJ66_BCL2A1-      -----------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
A0A2R8ZJ66_BCL2A1-      -----------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
A0A2R8Z9D7_BCL2L1-      REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQV
A0A2R9A2Q3_BCL2L2-      --------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQV
A0A2R9BPJ5_MCL1-02      --------PGGRLLATEKEASARREIGGGEAGAVIGGSA-GASPPSTLTP
A0A2R9BPJ5_MCL1-01      --------PGGRLLATEKEASARREIGGGEAGAVIGGSA-GASPPSTLTP
                                                                          

A0A2R8Z9D7_BCL2L1-      VNELFRDGV--NWGRIVAF----------FSFGGALCVE-----------
A0A2R9BCD9_BCL2L10      ADSVLSDSPGPTWGRVVTL----------VTFAGTLLERGPLVTTRWKKW
A0A2R9A2Q3_BCL2L2-      SDELFQGGP--NWGRLVAF----------FVFGAALCAE-----------
A0A2R9A2Q3_BCL2L2-      LEAHF-HGCG-SVNRVTILCDKFSGHPKGFAYIEFSDKE-----------
A0A2R9APW6_BCL2-01      VEELFRDGV--NWGRIVAF----------FEFGGVMCVE-----------
A0A2R9BPJ5_MCL1-03      MIHVFSDGVT-NWGRIVTL----------ISFGAFVAKH-----------
A0A2R8ZJ66_BCL2A1-      MEKEFEDGII-NWGRIVTI----------FAFEGILIKK-----------
A0A2R8ZJ66_BCL2A1-      MEKEFEDGII-NWGRIVTI----------FAFEGILIKK-----------
A0A2R8ZJ66_BCL2A1-      MEKEFEDGII-NWGRIVTI----------FAFEGILIKK-----------
A0A2R8Z9D7_BCL2L1-      VNELFRDGV--NWGRIVAF----------FSFGGALCVE-----------
A0A2R9A2Q3_BCL2L2-      SDELFQGGP--NWGRLVAF----------FVFGAALCAE-----------
A0A2R9BPJ5_MCL1-02      DSRRVARPP--PIGAEV---------------------------------
A0A2R9BPJ5_MCL1-01      DSRRVARPP--PIGAEV---------------------------------
                            .        .  .                                 

A0A2R8Z9D7_BCL2L1-      ----SVDKEMQVLVS---RIAAWMATYLNDHLE-----------PWIQEN
A0A2R9BCD9_BCL2L10      GFQPRLKEQEGDVARDCQRLVALLSSRLVGQHR-----------AWLQAQ
A0A2R9A2Q3_BCL2L2-      ----SVNKEMEPLVG---QVQEWMVAYLETRLA-----------DWIHSS
A0A2R9A2Q3_BCL2L2-      ----SVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
A0A2R9APW6_BCL2-01      ----SVNREMSPLVD---NIALWMTEYLNRHLH-----------TWIQDN
A0A2R9BPJ5_MCL1-03      ----L---KTINQESCIEPLAESITDVLVRTKR-----------DWLVKQ
A0A2R8ZJ66_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQN
A0A2R8ZJ66_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQN
A0A2R8ZJ66_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTG-----------EWIRQN
A0A2R8Z9D7_BCL2L1-      ----SVDKEMQVLVS---RIAAWMATYLNDHLE-----------PWIQEN
A0A2R9A2Q3_BCL2L2-      ----SVNKEMEPLVG---QVQEWMVAYLETRLA-----------DWIHSS
A0A2R9BPJ5_MCL1-02      -----------PDVT---ATPARLLFFAPTRRA-----------APLEEM
A0A2R9BPJ5_MCL1-01      -----------PDVT---ATPARLLFFAPTRRA-----------APLEEM
                                               :                          

A0A2R8Z9D7_BCL2L1-      GGWD-------TFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGS
A0A2R9BCD9_BCL2L10      GGWD-------GFCHFFRTPFPLAFWR-KQLVQAFLSCLLTTAFIYLWTR
A0A2R9A2Q3_BCL2L2-      GGWA-------EFTALYGDGALEEARR-LREGNWASVRTVLTGAVALGAL
A0A2R9A2Q3_BCL2L2-      TNYNSSRS---RFYSGFNSRPRGRVYR-SG--------------------
A0A2R9APW6_BCL2-01      GGWD-------AFVELYGP-SMRPLFD-FSWLSLKTLLSLALVGACITLG
A0A2R9BPJ5_MCL1-03      RGWD-------GFVEFFHVEDLEGGIR-NVLLAFAGVAGVGAGLAYLIR-
A0A2R8ZJ66_BCL2A1-      GGWGKWHNHTPMLVESVAH-------K-KRKMAL----------------
A0A2R8ZJ66_BCL2A1-      GGWEN------GFVKKFEH-------K-SGWMTFLEVTGKISILLTRKDT
A0A2R8ZJ66_BCL2A1-      GGWEN------GFVKKFEH-------K-SGWMTFLEVTGKICEMLSLLKQ
A0A2R8Z9D7_BCL2L1-      GGWDT----------------------------FVELYGNNAAAESR---
A0A2R9A2Q3_BCL2L2-      GGWELEAIK--ARVREMEEEAEK----------LKELQNEVEKQMNMSPP
A0A2R9BPJ5_MCL1-02      EAPAADAIM--SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGS
A0A2R9BPJ5_MCL1-01      EAPAADAIM--SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGS
                                                                          

A0A2R8Z9D7_BCL2L1-      LFSRK---------------------------------------------
A0A2R9BCD9_BCL2L10      LL------------------------------------------------
A0A2R9A2Q3_BCL2L2-      VTVGAFFASK----------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      AYLGHK--------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      PYCETGLIFLTVMETIANTYFYF---------------------------
A0A2R8ZJ66_BCL2A1-      -YC-----------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      PGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT
A0A2R9BPJ5_MCL1-02      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
A0A2R9BPJ5_MCL1-01      LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKA
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      ---------------------KGQERF-----------------------
A0A2R9A2Q3_BCL2L2-      ILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------IP
A0A2R9BPJ5_MCL1-02      LETLRRVG-------------DGVQRN---HETAFQGWVCGV--------
A0A2R9BPJ5_MCL1-01      LETLRRVG-------------DGVQRN---HETAFQGMLRKLDIKNEDDV
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      KRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGR
A0A2R9BPJ5_MCL1-02      ---------LPCRGPRRW---------------------HQECAAGFCRC
A0A2R9BPJ5_MCL1-01      KSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAES
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8ZJ66_BCL2A1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      ---------NRWFLTGMTVAGVVLLGSLFSRK------------------
A0A2R9A2Q3_BCL2L2-      ARA------TSWYSPY----------------------------------
A0A2R9BPJ5_MCL1-02      CWS------RSWF---------------------------------GISN
A0A2R9BPJ5_MCL1-01      ITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA
                                                                          

A0A2R8Z9D7_BCL2L1-      -------
A0A2R9BCD9_BCL2L10      -------
A0A2R9A2Q3_BCL2L2-      -------
A0A2R9A2Q3_BCL2L2-      -------
A0A2R9APW6_BCL2-01      -------
A0A2R9BPJ5_MCL1-03      -------
A0A2R8ZJ66_BCL2A1-      -------
A0A2R8ZJ66_BCL2A1-      -------
A0A2R8ZJ66_BCL2A1-      -------
A0A2R8Z9D7_BCL2L1-      -------
A0A2R9A2Q3_BCL2L2-      -------
A0A2R9BPJ5_MCL1-02      KIALL--
A0A2R9BPJ5_MCL1-01      GLAYLIR
                               

© 1998-2022Legal notice