Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z9D7_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLS----
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A2R8ZJX9_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A2R9A2Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2R9A2Q3_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2R9BPJ5_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2R9BCD9_BCL2L10      --------------MVDQWRERTTMADPLRERTERLLADYLGY-------
A0A2R9APW6_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLS----
A0A2R9BPJ5_MCL1-03      ---------------------------MFGLKRNAV----IGLNLY----
                                                                          

A0A2R8Z9D7_BCL2L1-      -QKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNG
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      -----IPQPGSG--------------------------------------
A0A2R8ZJX9_BCL2A1-      -----IPQPGSG--------------------------------------
A0A2R9A2Q3_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A2R9A2Q3_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A2R9BPJ5_MCL1-01      GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFA
A0A2R9BCD9_BCL2L10      ----CAREPGTPE-------------------------------------
A0A2R9APW6_BCL2-01      -QRGYEWDAGDVG-------------------------------------
A0A2R9BPJ5_MCL1-03      -CGGAGLGAGSGG-------------------------------------
                                                                          

A0A2R8Z9D7_BCL2L1-      ATGHSSSLDAREVIPMAAV-------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      -----------EGPAADPL-------------------------------
A0A2R9A2Q3_BCL2L2-      -----------EGPAADPL-------------------------------
A0A2R9BPJ5_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2R9BCD9_BCL2L10      -----------PTP------------------------------------
A0A2R9APW6_BCL2-01      -----------AAP------------------------------------
A0A2R9BPJ5_MCL1-03      -----------ATPPGGRL-------------------------------
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9BPJ5_MCL1-01      GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------LATGAKDTKPMG
                                                                          

A0A2R8Z9D7_BCL2L1-      ---------KQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQV
A0A2R8Z9D7_BCL2L1-      -----------MWKRTGLRPQKGLNRRWRPPVPSMATHP-GTAYQSFEQV
A0A2R8ZJX9_BCL2A1-      -----PSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
A0A2R8ZJX9_BCL2A1-      -----PSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
A0A2R9A2Q3_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQV
A0A2R9A2Q3_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQV
A0A2R9BPJ5_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRV
A0A2R9BCD9_BCL2L10      -----STPEAAVLRSAAARLRQIHRSFFSAYLG----YP-GNRFELVALM
A0A2R9APW6_BCL2-01      -LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATV
A0A2R9BPJ5_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRV
                                     . ..                             .  :

A0A2R8Z9D7_BCL2L1-      VNELFRDG--VNWGRIVAFFSFGGAL------------------CVESVD
A0A2R8Z9D7_BCL2L1-      VNELFRDG--VNWGRIVAFFSFGGAL------------------CVESVD
A0A2R8ZJX9_BCL2A1-      MEKEFEDGI-INWGRIVTIFAFEGIL------------------IKKLLR
A0A2R8ZJX9_BCL2A1-      MEKEFEDGI-INWGRIVTIFAFEGIL------------------IKKLLR
A0A2R9A2Q3_BCL2L2-      SDELFQGG--PNWGRLVAFFVFGAAL------------------CAESVN
A0A2R9A2Q3_BCL2L2-      SDELFQGG--PNWGRLVAFFVFGAAL------------------CAESVN
A0A2R9BPJ5_MCL1-01      MIHVFSDGV-TNWGRIVTLISFGAFV------------------AKHLKT
A0A2R9BCD9_BCL2L10      ADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGFQPRLKEQE
A0A2R9APW6_BCL2-01      VEELFRDGV--NWGRIVAFFEFGGVM------------------CVESVN
A0A2R9BPJ5_MCL1-03      MIHVFSDGV-TNWGRIVTLISFGAFV------------------AKHLKT
                            : ..   .***:*::. * . :                        

A0A2R8Z9D7_BCL2L1-      KEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD--------------
A0A2R8Z9D7_BCL2L1-      KEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD--------------
A0A2R8ZJX9_BCL2A1-      QQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG--------------
A0A2R8ZJX9_BCL2A1-      QQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE--------------
A0A2R9A2Q3_BCL2L2-      KEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWA--------------
A0A2R9A2Q3_BCL2L2-      KEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEE
A0A2R9BPJ5_MCL1-01      INQESCIE---PLAESITDVLVRTKRDWLVKQRGWD--------------
A0A2R9BCD9_BCL2L10      GDVARDCQ---RLVALLSSRLVGQHRAWLQAQGGWD--------------
A0A2R9APW6_BCL2-01      REMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD--------------
A0A2R9BPJ5_MCL1-03      INQESCIE---PLAESITDVLVRTKRDWLVKQRGWD--------------
                         :          :   :   :      *:  . **               

A0A2R8Z9D7_BCL2L1-      --------------------------------------------TFVELY
A0A2R8Z9D7_BCL2L1-      --------------------------------------------TFVELY
A0A2R8ZJX9_BCL2A1-      -------------------------------------KWHNHTPMLVESV
A0A2R8ZJX9_BCL2A1-      -------------------------------------N------GFVKKF
A0A2R9A2Q3_BCL2L2-      --------------------------------------EFTALYGDGALE
A0A2R9A2Q3_BCL2L2-      AEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYG
A0A2R9BPJ5_MCL1-01      --------------------------------------------GFVEF-
A0A2R9BCD9_BCL2L10      --------------------------------------------GFCHFF
A0A2R9APW6_BCL2-01      --------------------------------------------AFVELY
A0A2R9BPJ5_MCL1-03      --------------------------------------------GFVEFF
                                                                          

A0A2R8Z9D7_BCL2L1-      GNNAAAESR-KGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------
A0A2R8Z9D7_BCL2L1-      GNNAAAESR-KGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------
A0A2R8ZJX9_BCL2A1-      AHKKRKMAL-----------------------------------------
A0A2R8ZJX9_BCL2A1-      EHKSGWMTFLEVTGKICEMLSLLKQYC-----------------------
A0A2R9A2Q3_BCL2L2-      EARRLREGNWASVRTVLTGAVALGALVTVGAFFASK--------------
A0A2R9A2Q3_BCL2L2-      ATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLAL
A0A2R9BPJ5_MCL1-01      FHVEDLE------GGIRNVLLAFAGVAGVGAGLAYL-------IR-----
A0A2R9BCD9_BCL2L10      RTPF-PLAFWR--KQLVQAFLSCLLTTAFIYLWTRLL-------------
A0A2R9APW6_BCL2-01      GPSMRPLFDFS--WLSLKTLLSLALVGACITLGAYLGHK-----------
A0A2R9BPJ5_MCL1-03      -----HVEDLE--GGIRNVLLAFAGVAGVGAGLAYLIR------------
                                                                          

A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      DESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYS
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2R8Z9D7_BCL2L1-      ------------------------
A0A2R8Z9D7_BCL2L1-      ------------------------
A0A2R8ZJX9_BCL2A1-      ------------------------
A0A2R8ZJX9_BCL2A1-      ------------------------
A0A2R9A2Q3_BCL2L2-      ------------------------
A0A2R9A2Q3_BCL2L2-      GFNSRPRGRVYRGRARATSWYSPY
A0A2R9BPJ5_MCL1-01      ------------------------
A0A2R9BCD9_BCL2L10      ------------------------
A0A2R9APW6_BCL2-01      ------------------------
A0A2R9BPJ5_MCL1-03      ------------------------
                                                

© 1998-2020Legal notice