Dataset for protein Bfl1 of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :       :*:.. **. .
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWgn------mlVksveHKsrw
                                                            ekwhnhtpgf ekfa  kgk

       170       180 
....:....|....:....|.
*::                  
Mtl------------------
 aflevtgkicemlsllkqyc
© 1998-2020Legal notice