Dataset for protein Bfl1 of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8ZJX9_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEK
A0A2R8ZJX9_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEK
                        **************************************************

A0A2R8ZJX9_BCL2A1-      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2R8ZJX9_BCL2A1-      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A2R8ZJX9_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------GF
A0A2R8ZJX9_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPML
                        **************************************** :       :

A0A2R8ZJX9_BCL2A1-      VKKFEHKSGWMTFLEVTGKICEMLSLLKQYC
A0A2R8ZJX9_BCL2A1-      VESVAHKKRKMAL------------------
                        *:.. **. .*::                  

© 1998-2020Legal notice